kin




FC2MIAADASDHODVONEZSTARSMIDVKSBJMARAAPODNACXCJODATIDMILKADNPPPDHNDMEYDFSDSSGMEMHZGD

2020-12-27
115 min

[JJBB-0002]We Heard About This Mature Woman Pink Salon Where The Ladies Were Loose And Easy, So We Decided To See How Far We Could Go 02

  • censoredcreampiemarried womanJJBBmature japanJJBB-0002JJBB0002jjbb000002
    • 2021-01-05
    122 min

    [MSFH-046]Her Excitement Is Only Exceeded By Her Shame... An Elegant And Intelligent, Beautiful Woman Is Engaged In Shameful, Crude Dirty Talk Konomi Yoshinaga

  • konomi yoshinaga censoredbig titssingle workMSFHsod createevening editionms sodMSFH-046MSFH0461msfh00046
    • 2021-01-08
    17 min

    FC2PPV 1637519 [3p, Leak] A horny girl friend wants to go on a trip, so when I let M man accompany me, the rectal examination started and the grass

  • amateur uncensoredfc2
    • 2021-01-09
    69 min

    200GANA-2421 In the spear room of the Nampa teacher of 100 battles, brought in SEX hidden shooting 187 A busty married woman who brought in with a half-drunk momentum. In addition to the loneliness that her husband hasn’t dealt with recently, sh

  • amateur censoredbig titsmarried womanganagana-2421gana2421200gana-2421
    • 2021-01-16
    104 min

    390JAC-074 [Shake G milk GAL x 4 vaginal cum shot] G splash! !! G milk and tide festival begins! Creampie large board behavior! Saddle tide large board behavior! Revolutionary large amount of 711ml sperm that loops 1G cum shot! The strongest masterpi

  • ggal censoredcreampiebig titsjacjac-074jac074390jac-074
    • 2021-01-21
    303 min

    [SVOMN-152]Surveillance Invasion A Creampie Fuck Fest! A Teacher, A J* A Nurse Are All Getting Fucked And They're Squirting! Squirting! Squirting! 18 Titles A 5-Hour Collection

  • censoredcreampiesquirtingSVOMNsadistic villageSVOMN-152SVOMN1521svomn00152
    • 2021-01-23
    119 min

    [NNPJ-426]Picking Up Girls In Shibuya At Midnight - They've Missed The Last Train, They're Easy Prey For a Fuck

  • censoredcreampiebeautiful girlNNPJnanpa japanNNPJ-426NNPJ426nnpj00426
    • 2021-01-24
    138 min

    [ANZD-056]コスプレHが大好きな巨乳図書館司書 みずき

  • censoredbig titsamateurANZDanzu daydream vacationanzuANZD-056ANZD056anzd00056
    • 2021-01-25
    57 min

    [tkwa-154]はな 2

  • amateur censoredcreampiebig titstkwatkwa-154tkwa154tkwa-154
    • 2021-01-29
    32 min

    [moj-004]カレン

  • amateur censoredcreampieamateurmojmoj-004moj004moj-004
    • 2021-02-20
    45 min

    FC2PPV 1694654 [Individual shooting] Emergency contact from the beautiful captain of the volleyball club! Help me run out of money! The finest J system and raw paco vaginal cum shot prepared for pregnancy

  • amateur uncensoredfc2
    • 2021-03-13
    180 min

    [MIDE-897]Is It OK If I Come Over To Your Place？ Shocking Call Girl SEX!! 200 Devilish Seduction - She's A Tease! Mia Nanasawa

  • nanasawa mia censoredbeautiful girlslutMIDEmoodyzgoemonmoodyz divaMIDE-897MIDE897mide00897
    • 2021-04-15
    240 min

    [OKAX-728]Penetrative Sex Negotiation At A Massage Parlor With Only Beautiful Young Wives Rough Sex Caught On Film WIth A Small Camera 240 Minutes

  • censoredmarried womanmature womanOKAXkm producedick poisonside dishesOKAX-728OKAX728okax00728
    • 2021-04-20
    252 min

    [FTOM-004]POV Shots Of Amateurs We Met On SNS "We're Now At Marriageable Age" Amateur Girls 4 Girls 4 Hour Special

  • censoredcreampieamateurFTOMfuutubeakiba masatoamateur gonzo circleFTOM-004FTOM004h-1068ftom00004
    • 2021-05-01
    120 min

    [BBAN-325]Dream Fulfilled! I Want To Experience Pleasure Like No Other By Being Disciplined By My Beloved Eri Akira Wakana Shiroyama Eri Akira

  • shiroyama wakana aki erie arai erie yuka osawa censoredsquirtinglesbianBBANbibianBBAN-325BBAN325bban00325
    • 2021-05-01
    120 min

    [PRED-308]Airi (My C***dhood Friend) Made A Serious Confession To Me That She Wanted To Suck My Dick, So She Spent The Entire Day Giving Me Oral Ejaculatory Pleasure, And I Became Hooked On Her Blowjob Technique ... Airi Kijima

  • airi kijima censoredcreampieuniformPREDpremiumsuisei akaielegancePRED-308PRED308pred00308
    • 2021-05-05
    59 min

    Caribbeancom 050521-001 Pretty Small Tits: Eri Saeki

  • eri saeki uncensoredcreampiecaribbeancom
    • 2021-05-05
    89 min

    374IMGN-008 Himari

  • amateur censoredbig titsamateurimgnimgn-008imgn008374imgn-008
    • 2021-05-07
    59 min

    230OREC-756 Yukino

  • amateur censoredcreampieamateurorecorec-756orec756230orec-756
    • 2021-05-18
    54 min

    299EWDX-360 Beautiful Wife With Fair-skinned Big Tits! I’m confused, but SEX is a weak type to push! ？？

  • amateur censoredcreampiebig titsewdxewdx-360ewdx360299ewdx-360
    • 2021-05-20
    114 min

    [AKDL-111](Fuckable Women At The Workplace) The Big Tits Girl In The Knit Sweater A Sexual Record Of Creampie Sex And Cum Swallowing During Work With My Fuck Buddy Sales Department (24 Years Old) Rui-chan Rui Miura

  • rui miura censoredcreampiebig titsAKDLaquinoriaquinoriaknrAKDL-111AKDL1111akdl00111
    • 2021-05-22
    136 min

    [CEMD-012]First Lesbian Unleashed! Aya Shoimi Gets Lesbian Training From Rena Aoi

  • aya shiomi blue censoredlesbianmature womanCEMDceleb no tomoCEMD-012CEMD012cemd00012
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-14
    154 min

    [PPPD-941]19 Year Old Girl With Over 10,000 Followers On A Video App! H-Cup Big Titty Influencer Porn Debut Rei Ichihara

  • rei ichihara censoredbig titssingle workPPPDoppaiPPPD-941PPPD941pppd00941
    • 2021-07-22
    126 min

    [JRZE-063]First Time Filming My Affair. Arisa Funaki.

  • arisa funaki censoredcreampiemature womanJRZEcenter villageminatoyajurakuJRZE-063JRZE063h-086jrze00063
    • 2021-08-06
    49 min

    FC2PPV 1960512 ★ 1,280pt Until 8/15 (Sun) For A Limited Time !! [No / Individual] Active Jd (21) With Strong Libido And Echi Echi Soft Body Gonzo ♪ Naked Y-Shaped Balance & Split Split To See The Dick! !! !! * High-Quality Review Benefits Availabl

  • amateur uncensoredfc2
    • 2021-08-13
    148 min

    [PPPD-953]The Impact Of Unprotected Sex! Her First Time With Creampie SEX. Screams Of Really Big Convulsive And Megatonic Orgasms During Unprotected Sex. Arisu Kisaki.

  • kisaki alice censoredcreampiebig titsPPPDoppaiPPPD-953PPPD953pppd00953
    • 2021-08-13
    191 min

    [ROYD-066]My C***dhood Friend And Little Stepsister Love Me So Much That They Fight Over Tempting And Fucking Me. Aoi Kururugi, Yuna Himekawa

  • aoi kururugi ran tsukishiro yuna himekawa censoredsisterROYDroyalkawajirihhh groupROYD-066ROYD066royd00066
    • 2021-08-14
    37 min

    FC2PPV 2021806 [Caution For Immediate Deletion] ●● A Miracle Encounter Between A Super Beautiful Active Idol Who Belongs To Familia And A Daddy Activity Site. I Got Consent To Take A Vaginal Cum Shot Because I Wanted Cash Due To A Drastic Decrease In

  • amateur uncensoredfc2
    • 2021-08-31
    61 min

    HEYZO 2603 Get Laid With A Busty Beauty At Premium Soapland Vol.2 – Asaka Sera

  • asaka sera uncensoredcreampiehandjobheyzo
    • 2021-09-01
    120 min

    [NACR-454]Confinement And Influence: I Was Disciplined By My Brother-in-law - Akane Shiki

  • akane shiki censoredcreampieblowjobNACRplanet plussakura ninshichi ku ryuuNACR-454NACR454h-237nacr00454
    • 2021-09-04
    125 min

    [SOAN-065]After Her Husband And C***d Go To Sleep, This Horny MILF Is Getting Both Her Holes Rocked Through The Night, Starting On Monday ... Her Husband Has Cuckold Fantasies, So We Indulged His Tastes By Featuring This Horny Housewife In A Real Fuc

  • censoredamateurSOANyama to soratanizoko fu taroukoumon houmonSOAN-065SOAN065soan00065
    • 2021-09-12
    43 min

    FC2PPV 2192701 Super Popular "Saki Hatsumi" [No] Raw Vaginal Cum Shot Outflow 12 / Massive Man Juice Of Joy! A Little Detention 〇 Idol Falls Saffle Trilogy Novella

  • amateur uncensoredfc2
    • 2021-09-18
    131 min

    [AGAV-063]The Greatest Ass - Endless Bukkake With A 95cm Pretty Ass - Rima Kawahara

  • rima kawahara censoredsingle workAGAVsex agentyoshida daibutsuAGAV-063AGAV063agav00063
    • 2021-09-24
    77 min

    518ASGM-021 [Sleep Fucking / Intravaginal Ejaculation] Itabashi-Ku Petite Beautiful Girl Hidden Shooting (Tokyo / Ordinary Course) Estimated A Cup (Ryomi Honoka)

  • amateur censoredcreampieuniformasgmasgm-021asgm021518asgm-021
    • 2021-10-02
    53 min

    FC2PPV 2285597 Luxury Men’s Esthetic ＃ 31 Aika Kirishima [Tokyo Hands @ Men’s Esthetic]

  • amateur uncensoredfc2
    • 2021-10-07
    87 min

    [HIMA-095]Genuine A Stepmother/Stepson Fuck Fest A Stepmother And Stepson Have Nowhere To Turn To But Each Other, As They Engage In Forbidden Impregnation Sex Kanako Haraguchi

  • natsuko haraguchi censoredcreampiemarried womanHIMAcenter villageshibuyahanazono center villageHIMA-095HIMA095h-086hima00095
    • 2021-10-08
    244 min

    [VENX-082]Meet The S*****t Council Brats Who Group Fucked Their Hot Teacher And The Sexy PTA Chairwoman Honoka Kimura & Yuri Mizukawa

  • censoredcreampiemature womanVENXvenusincest vi nasuVENX-082VENX082venx00082
    • 2021-10-30
    113 min

    [XVSR-620]Slutty Masseuse Rika Aimi Kneading Nipples With Pile-Driving Pistons

  • rumi tadami censoredcreampiebig titsXVSRmax ayoshida ikuzoucalenXVSR-620XVSR620xvsr00620
    • 2021-11-04
    65 min

    413INST-180 [Youth Orgy] ♂ ♀ 4 People Adolescent Bunny With Pleasure Oil Nipples Erected, Intense Acme Convulsions Iki Can Not Stop! A Friend Cums In Front Of Her Boyfriend W (Rena Aoi Mai Yahiro)

  • amateur censoredcreampieschoolgirlinstinst-180inst180413inst-180
    • 2021-11-12
    123 min

    [BOBB-325]We"re Bringing Out The Absolute Best Of Her Alluring, Divine J-Cup Colossal Tits! Super Selections! 6 Situations Boin "Misono Mizuhara" Box 2 If You"re Into Fetishes, Check Out (Our Proudest Accomplishments) Videos

  • suwon miso censoredbig titscosplayBOBBabc mousou zokuboinbb abc mousou zokuBOBB-325BOBB325bobb00325
    • 2021-11-16
    119 min

    [KTRA-345]The Everyday Life Of A Step-Father And Step-Daughter Succumbing To Their Lust Mai Kagari

  • mai hanakari censoredcreampiecosplayKTRAk tribeKTRA-345KTRA345
    • 2021-11-30
    66 min

    FC2PPV 2476404 For the first time, a beautiful woman dressed in a racy costume got anal without permission ♥♥

  • amateur uncensoredfc2
    • 2021-12-03
    119 min

    [MIDV-014]One Facial On Top Of Another Facial, With A Huge Load Of Spunk - Nao Jinguji

  • jinguji temple nao censoredbeautiful girlslutMIDVmoodyzoosaki hirokoujimoodyz divaMIDV-014MIDV014midv00014
    • 2021-12-11
    185 min

    [DNJR-064]Real Ejaculation Management To Watch One Scene At A Time, One Day At A Time Mao Hamasaki

  • hamazaki mao censoredbig titsslutDNJRdog daydreamersmaboroshikoDNJR-064DNJR064dnjr00064
    • 2021-12-11
    67 min

    FC2PPV 2504630 [Individual Shooting] No88 Yui-Chan 18-Year-Old Ss-Class Beautiful Girl Is Intensely Pistoned By The Second Etch Of Her Life And Is In Agony With Man Juice Dripping, Tapping Into A Beautiful Girl Who Longs For Going Out, Pregnancy Is R

  • amateur uncensoredfc2
    • 2021-12-16
    223 min

    [VOV-071]Strongest Bitch Collection! Bead Connecting Orgy Sex Party Vol.6. "Introduce Me To A Friend Hornier Than You"

  • censoredcreampiebig titsVOVit s thursday everyone gatheredorgy from thursdayVOV-071VOV071h-1350vov00071
    • 2021-12-17
    76 min

    [HEYZO-2690]Ena Requesting The POV Fuck Option -Yokohama-

  • ena uncensoredheyzo



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download