kana




FC2AUKGWANZFSDSSAUKGMVSDLULUNATRSDABROYDAPODVENUKSBJBLKCHRVMILKHNDMIDVPPPDMEYDSTARS

2020-12-31
70 min

200GANA-2414 Seriously Nampa, first shot. 1576 Successful pick-up of a kind-hearted nursery teacher! I got the goddess who forgives me even if I rubbed the fluffy G cup boobs as it is ♪

  • amateur censoredbig titsamateurganagana-2414gana2414200gana-2414
    • 2021-01-11
    45 min

    362SCOH-023 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [● Red]

  • amateur censoredcreampieamateurscohscoh-023scoh023362scoh-023
    • 2021-01-28
    45 min

    C0930 ki210128 Mayumi Ono 30years old

  • amateur uncensoredc0930
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    118 min

    [FSDSS-167]Hottie Groped By Sticky Pervs, Mayoi Arisaka

  • arisaka mayoi censoredbig titssingle workFSDSSfalenocaptain eharafaleno starFSDSS-167FSDSS1671fsdss00167
    • 2021-02-25
    66 min

    413INST-099 Reika Chan 20 years old God level beautiful girl advent! A metamorphosis girl who wants to be an announcer who drips love juice just by taking a picture of the shame ♪ “It will break! It will break ♪” Ignore the screaming cancer

  • amateur censoredamateurbeautiful girlinstinst-099inst099413inst-099
    • 2021-02-26
    45 min

    FC2PPV 1697954 [No] Yurufuwa Married Woman Aya-san, a cheating wife who responds with a margin even though she is likely to get a phone call during sex. [Individual shooting]

  • amateur uncensoredfc2
    • 2021-03-01
    99 min

    [hoi-163]マリナ(20)

  • amateur censoredamateurbeautiful girlhoihoi-163hoi163hoi-163
    • 2021-03-06
    43 min

    H0930 ki210307 Hirono Suematsu 30years old

  • amateur uncensoredh0930
    • 2021-03-13
    119 min

    [MEYD-662]The Married Woman Next Door Complained Every Day About The Noises From My TV, Because I Liked To Watch Adult Videos, But I Complained Right Back And Told Her, "Well I Can Hear You Masturbating All The Time Too!" And When This Horny

  • emi fukada aika censoredcreampieblowjobMEYDtameike gororyo inugamiMEYD-662MEYD662meyd00662
    • 2021-03-25
    120 min

    [ARSO-21144]My Wife -Celeb Club- 144

  • kaori ishihara ran koda censoredblowjobARSOaroundARSO-21144ARSO21144h-1378arso21144
    • 2021-03-26
    239 min

    [OKAX-721]This Dirty Old Man Says, I'll Teach You The Secrets Of Sexual Pleasure I Thought I Absolutely Hated Him, But He Made Me Feel So Good When He Toyed With My Sensual Cunt Crack 12 Girls 4 Hours 3

  • censoredcreampieblowjobOKAXk m produceokazuOKAX-721OKAX72184okax00721
    • 2021-03-27
    136 min

    [KNMB-011]Totally Raw STYLE @ Rimi #Half-In, Half-Out #G-Cup Colossal Tits #True Nature #Her First Slutty Video #Busty S********l #Cum-Swilling Pussy #Sugar Babe #Creampie Rimi Momono

  • rimi momono censoredcreampiebig titsKNMBfirst star100 raw styleKNMB-011KNMB011h-491knmb00011
    • 2021-04-14
    149 min

    [SSIS-037]Do You Want Yua Mikami To Tease You？ You Do, Don't You？

  • yua mikami censoredbig titsslutSSISs1 no 1 stylemon cSSIS-037SSIS037ssis00037
    • 2021-04-17
    66 min

    FC2PPV 1773439 [Limited Premier] 3 former popular idols-Caution for immediate deletion-

  • amateur uncensoredfc2
    • 2021-04-28
    39 min

    517MQXT-003 Cum Hell! A girl who cries for whole body oily blame and double-hole teasing

  • amateur censoredanalschoolgirlmqxtmqxt-003mqxt003517mqxt-003
    • 2021-05-01
    124 min

    [NACR-422]Horny Stepmoms Shihori Endo

  • gloss hall shiori endo bookmark censoredcreampiemature womanNACRplanet plusdirector onanakuruNACR-422NACR422h-237nacr00422
    • 2021-05-13
    69 min

    200GANA-2476 Seriously Nampa, first shot. 1635 Frustrated with premature ejaculation husband？ Talked to your favorite younger salt-faced actor and completely estrus! It looks elegant, but it has a faint scent of lasciviousness. !!

  • amateur censoredbig titsmarried womanganagana-2476gana2476200gana-2476
    • 2021-05-15
    115 min

    [BIJN-199]The Documentary Orgasmic Basic Instinct-Baring Sex A Tall Office Lady With Beautiful Legs Is Baring Her Female Instinct To Have Furious, Passionate, Cum-Crazy Fucking Sex Himari Kinoshita

  • himari kinoshita himari hanazawa censoredsingle workBIJNbijin majo emmanuelleBIJN-199BIJN199bijn00199
    • 2021-05-20
    38 min

    FC2PPV 1827016 [Bonus delivery] Non-contraceptive 18-year-old student with a childish body ◯ This is the first vaginal cum shot in my life.

  • amateur uncensoredfc2
    • 2021-05-20
    121 min

    [DLDSS-006]Step Mother Lover My Incredible Step Mom Craves Me Every Day Ayaka Tomoda

  • ayaka tomoda censoredcreampiesingle workDLDSSdahliapassionate employeeDLDSS-006DLDSS0061dldss00006
    • 2021-06-04
    157 min

    [HUNBL-047]"We're Finally Together, Just The Two Of Us ... I Won't Let You Get Away ..." A Crazy Private Tutor Chased This Sch**lgirl All Over The House

  • censoredcreampieschoolgirlHUNBLhuntergeminihhh groupHUNBL-047HUNBL047hunbl00047
    • 2021-06-06
    76 min

    476MLA-022 [Back Customs x F Breasts x Skillful Day Trader] A super gap of the ultimate beautiful BODY with a baby face! Juicy de nasty Ma ○ Ko gets sick! Inevitable erection is the reverse piss that shakes the hips with Erokos SEX! !! 4 barrage to s

  • amateur censoredcreampiebig titsmlamla-022mla022476mla-022
    • 2021-06-12
    241 min

    [NASH-522]A Married Woman Who Turns Her Husband Into A Cuckold While He Doesn't Notice

  • ayako inoue kumi kanzaki censoredmature womandramaNASHnadeshikoNASH-522NASH522nash00522
    • 2021-06-17
    112 min

    [OMHD-008]Refrigerator Girl I Put My Step Sister In The Refrigerator And Turned Her Into A Frozen Sex Toy Nana Maeno

  • nana maeno censoredsisterdeepthroatOMHDdogmamigiwa otaOMHD-008OMHD008omhd00008
    • 2021-07-07
    150 min

    Caribbeancom 070721-001 Bikini Anthology2 Emiri Okazaki, Kokomi Hoshino, Airi Minami, Mami Yuki, Yuki Asami, Mami Uehara, Tsubasa Saeki, Hikari Tukino, Mahiru Hino, Eri Hoshikawa

  • amateur uncensoredcreampiehandjobcaribbeancom
    • 2021-07-09
    134 min

    [DASD-888]Living in Azabu, Minato City. Sex Service with Big-Assed Married Women in a High-Rise Condominium Building. Yu Shinoda .

  • shinoda yu censoredbig titssingle workDASDdasmishima rokusaburoDASD-888DASD888dasd00888
    • 2021-07-10
    142 min

    [USAG-032]Remi-chan (23) Dark Gyaru/Cuckold/NTR/Big Ass/Facial Cumshot/Creampie/3 Cock Group Sex/POV/Threesome

  • censoredbig titsUSAGrabbit daydreamersUSAG-032USAG032usag00032
    • 2021-07-14
    119 min

    [JYMA-012]She Tempts Men With Her Voluptuous, Sexually Frustrated Body: A Married Masochistic Slut With A Freaky Sex Drive, A Plump Body, Colossal J Cup Jugs And A Thick Ass, Ready To Get Teased And Cum Over And Over

  • censoredcreampiebig titsJYMAjukujo ha tsurai yobuddha dmanji groupJYMA-012JYMA012jyma00012
    • 2021-07-22
    153 min

    [JUFE-313]Infinite Orgasms With Just Titty Teasing-Riho Fujimori

  • riho fujimori censoredslutsingle workJUFEfitchsamoariJUFE-313JUFE313jufe00313
    • 2021-07-26
    46 min

    IDJS-064 Maki

  • amateur censoredcreampieamateuridjsidjs-064idjs064idjs-064
    • 2021-07-30
    121 min

    [PRED-328]Creampie and Adultery With My Mistress (Airi) For Two Days At A Hot Spring While My Wife Is Out On A Business Trip Airi Kijima

  • airi kijima censoredcreampiesingle workPREDpremiumsapporo tarouelegancePRED-328PRED328pred00328
    • 2021-08-13
    280 min

    [DVDMS-700]Faces Finally Shown! The One-Way Mirror Cab Is Parked In Front Of A Famous University To Score Elite College Girl Sex! Hot Pants And Huge Dicks Fucking Raw Edition! Their Perky Booties Sticking Out From Their Teeny Tiny Shorts Plus Lots Of

  • censoredamateurDVDMSdeepsfunky haseithe magic mirrorDVDMS-700DVDMS700dvdms00700
    • 2021-08-13
    194 min

    [DVDMS-701]All First Experiences Of 18-Year Old Kiu Aihara! A Special Of Four Performances.

  • aihara tsukiha censoredcreampiebeautiful girlDVDMSdeepsfunky haseiDVDMS-701DVDMS701dvdms00701
    • 2021-09-03
    172 min

    [BF-640]My Lady Boss At My Part-Time Job Is Consumed By Her Work And Feeling Extremely Horny, So She Lured Me To Temptation, And Made Me Cum Until The Break Of Dawn At The Hotel. Kokona Asakura

  • asakura here censoredcreampiebig titsBFbefreerokuyonBF-640BF640bf00640
    • 2021-09-04
    101 min

    [SQTE-380]Honor S*****t Likes The Face Boys Make When They Feel Good! Mahiro Ichiki

  • mahiro ichiki censoredcreampieschoolgirlSQTEs cutes cute s cuteSQTE-380SQTE380sqte00380
    • 2021-09-09
    120 min

    [FSDSS-312]Reborn Debut Her Amazing And Shimmering Top-Class Waist Between Her Beautiful Tits And Ass. Ruru Amakuni

  • heave censoredcosplayFSDSSfalenoboomer 44faleno starFSDSS-312FSDSS3121fsdss00312
    • 2021-09-15
    133 min

    [GVH-289]His Personal Trainer is a Young Lady Who Has Plump, Colossal Tits. Mayu Suzuki

  • suzuki mayu censoredcreampiebig titsGVHglory questhyonGVH-289GVH289gvh00289
    • 2021-09-16
    124 min

    [AARM-015]Nipples Licked With His Face Buried In Her Huge Tits 2

  • nana matsumoto yuka hirose censoredbig titshandjobAARMaroma kikakukadowaki shigeoaromaAARM-015AARM015aarm00015
    • 2021-09-24
    150 min

    [DASD-919]Masseuse Pleasured Me So Much That I Came And Felt So Good Fukayuki Arisaka

  • arisaka miyuki censoredsingle workDASDdasmishima rokusaburoDASD-919DASD919dasd00919
    • 2021-10-07
    222 min

    [NHDTB-587]A Big Tits S********l In Uniform Gets Groped And Grabbed From Behind And Wiggles Her Ass On A Crowded Bus By A Titty Grabbing M****ter 14

  • censoredbig titsschoolgirlNHDTBnatural highjaken kodamaNHDTB-587NHDTB5871nhdtb00587
    • 2021-10-09
    141 min

    [DNJR-059]The Story of Yuna Himekawa"s Enticement and Confinement of, and Breaking In, a Masochistic Male. Yuna Himekawa

  • yuuna himekawa ran tsukishiro censoredbeautiful girlslutDNJRinu mousozokumaboroshi koDNJR-059DNJR059dnjr00059
    • 2021-10-23
    240 min

    [EYS-070]Picking Up Gals And Taking Them Home Highlights, Old Man Fucking! 12 Tsundere Specially Selected Women Make You Crazy 4 Hours

  • censoredcreampieamateurEYSstudio i sEYS-070EYS070eys00070
    • 2021-10-26
    65 min

    STOK-008 Natsu (Natsu Tojo)

  • amateur censoredamateurbeautiful girlstokstok-008stok008stok-008
    • 2021-10-30
    77 min

    H4610 ki211030 Himari Miyake 24years old

  • amateur uncensoredh4610
    • 2021-11-12
    48 min

    FC2PPV 2423546 Limited Number! !! [Uncensored] The Half-Beautiful Stylist Introduced In A Fashion Magazine Is Really Nasty! !! It’S Too Disturbed And It’S Vaginal Cum Shot Twice (Feature)

  • amateur uncensoredfc2
    • 2021-12-04
    74 min

    FC2PPV 2486345 An S-Class Beautiful Girl From A National Idol. She Released The Overwhelming Transparency That Was Active In Tv And Commercials, And The Miracle Gonzo That Played With The Body Of A Fair-Skinned Slender As Much As She Wanted.

  • amateur uncensoredfc2
    • 2021-12-07
    68 min

    SIRO-4704 [First Shot] [Beautiful Big Breasts] [Glossy Skin X Erotic Ass] Discovered An F Milk Beauty Who Has A Neat Feeling Like A Female Anna But Also Has A Magical Sex Appeal. She Shows Off Jupojupo And Outstanding Fellatio, And Her Deep Roots Bla

  • amateur censoredbig titsamateursirosiro-4704siro4704siro-4704



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download