javcensored various occupations planning censored jav




FC2SDABNATRJUFEFSDSSWANZAMBIJULSSISMARACAWDHNDSPRDSHKDMIDVMVSDAPODAUKSCJODPPPDAUKG

2020-12-17
152 min

[SSNI-949]155 Intense Orgasms! 5800 Spasms! 2000 cc Of Cum! Marshmellow G-Cup Mahina Amane's Erotic Awakening - Her First Extreme Climaxes Special

  • amane mahina censoredbig titssquirtingSSNIs1 no 1 styleusa pyonSSNI-949SSNI949ssni00949
    • 2020-12-18
    39 min

    [BTH-100]Make Me Cum By Throatfucking Me - Maina Yuna

  • yuuri censoredbeautiful girlBTHchobitchchovicBTH-100BTH100h-1435bth00100
    • 2020-12-27
    98 min

    [YROS-002]Outside Nudes Dance Lesbian - Moa Hoshizora, Hina Kamino

  • the starry sky jinno hina censoredlesbianYROSyuriecchi daydreamerspink monkeyyuriecchi yuriecchi daydreamersYROS-002YROS002yros00002
    • 2021-01-01
    59 min

    10musume 010221_01 Shouko Takeda

  • amateur uncensored10musume
    • 2021-01-08
    185 min

    [DANDY-745]Two Gals Scrambling For The Cock Of A Middle Aged Guy That They Really Don't Like!？ As Soon As He Showed Them A Wad Of Bills, He Was Fucked Over And Over Again Until His Sperm Stopped Coming Out

  • censoredDANDYdandykenkyo momoiroDANDY-745DANDY7451dandy00745
    • 2021-01-17
    66 min

    FC2PPV 1648397 [Super / treasure class] Former 〇〇! When I took off that rumored girl, it was amazing ❤️❤️

  • amateur uncensoredfc2
    • 2021-01-29
    50 min

    [per-360]ひまり

  • amateur censoredamateurblowjobperper-360per360per-360
    • 2021-01-30
    56 min

    [HHKL-083]She Crashed At My Place After A Party, So I Tried Hitting On Her And You Won't Believe What Happened. Yukine Amasawa

  • yukine amazawa censoredHHKLhunterkawajirihhh groupHHKL-083HHKL083hhkl00083
    • 2021-02-05
    115 min

    [PARATHD-3100]The Reason Why This Sixty-Something Widow Secretly Filmed Her Stepdaughter And Her Husband's Nightly Activities Deluxe Edition - When He Found Out The Reason, Her Son-In-Law Decided To Provide His Own Brand Of Comfort -

  • censoredamateurmature womanPARATHDparadise tvPARATHD-3100PARATHD3100parathd03100
    • 2021-02-10
    13 min

    S-Cute 805_urara_05 Cowgirl H with a cute shy smile after getting caught / Urara

  • urara censoredamateururaraurara-05urara05805-urara-05
    • 2021-02-12
    120 min

    [MDTM-704]First Time Having Sex With You - Ichika Kurokawa, Fresh Face, First Shots. AV Debut

  • kurokawa kazuhana censoredcreampieuniformMDTMuchu kikakutodoMDTM-704MDTM704h-585mdtm00704
    • 2021-03-01
    122 min

    [AMBI-121]Becoming My Perverted Stepfather's Plaything Beautiful Y********l In Uniform Has Her Relationship Ruined Mashiro Kisaragi

  • kisaragi mashiro censoredbeautiful girlsingle workAMBIplanetdirector oambibarentzAMBI-121AMBI121h-237ambi00121
    • 2021-03-03
    133 min

    [GVH-202]Ma*ko Device Bondage XX Tied Up And Shamed P**sies Kana Morisawa

  • kana morisawa kanako iioka censoreddeepthroatsingle workGVHglory questGVH-202GVH20213gvh00202
    • 2021-03-11
    93 min

    [OKK-024]Slick, Sweaty, Intimate Sex In A Nut-Busting Competitive Swimsuit - Mitsuha Higuchi - Enjoy This Tiny Teen At Her Wettest! Hidden Camera Voyeur Footage From The Change Room - From Tiny Boobs To Big Tits, Shaved Pussy, Hairy Snatches, And Arm

  • mitsuha higuchi censoredbeautiful girlsingle workOKKdaddy s private photosgodly swimming raceOKK-024OKK0241okk00024
    • 2021-03-18
    58 min

    FC2PPV 1730846 Big boobs world tremor! Miraculous I Cup Ubu Bishoujo First Leak [Limited Premier]

  • amateur uncensoredfc2
    • 2021-03-21
    119 min

    [NNPJ-437]My Lover Trashed Our Engagement ... *So Now I'm On A Rampage And Looking For A Sugar Daddy! With Every Cock Thrust, I'm Letting Go Of My Loneliness ... A Piston-Pumping Barely Legal Is Begging You To Soothe Her Broken Heart (The The

  • censoredcreampieblowjobNNPJnanpa japanNNPJ-437NNPJ437nnpj00437
    • 2021-03-23
    62 min

    FC2PPV 1738461 ★ First shot amateur ☆ Libido vigorous ♥ Spo girl Chika who defeats as long as physical strength is 21 years old ☆ Love juice betchori electric blame Iki ♥ Exciting stakeout piston cowgirl ♥ Gonzo cum shot ejaculation ♥ [Personal shoot

  • amateur uncensoredfc2
    • 2021-03-29
    46 min

    FC2PPV 1746662 [First shot / Non-stop creampie cum swallow] Blue ● young lady is cum swallowing in 39 minutes 4 cum swallowing circle 12 Leona

  • amateur uncensoredfc2
    • 2021-04-06
    220 min

    [STARS-357]18 Year Old Amateur Sexy Model Himari Asada All Exciting New Experiences Fucks 4 Times

  • himari asada censoredbig titsbeautiful girlSTARSsod createeasy matsumotosod starSTARS-357STARS3571stars00357
    • 2021-04-07
    28 min

    FC2PPV 1758624 [First shot / sold out] Former local idol self-activity fund, 2 cum swallows BJJ indies ＃ 10

  • amateur uncensoredfc2
    • 2021-04-14
    52 min

    FC2PPV 1770066 [4K shooting] [It’s dangerous if it gets caught, but somehow it appears] A certain netoge voice actor 19 years old ❤ A large amount of vaginal cum shot to a boyfriend’s shaved daughter in bloomers + knee high clothes! (Total

  • amateur uncensoredfc2
    • 2021-04-15
    180 min

    [DIPO-091]Hung Older Guy Secretly Films His Fucks With A Married Slut - Lost In Creampie Sex

  • censoredDIPOprimoero nandesuDIPO-091DIPO091h-283dipo00091
    • 2021-04-21
    57 min

    492JCHA-011 The most recent top ball JK

  • amateur censoreduniformschoolgirljchajcha-011jcha011492jcha-011
    • 2021-04-24
    244 min

    [HMJM-055]Super Best 4 Hours Mizuki Hayakawa

  • mizuki hayakawa censoredbig titssingle workHMJMhmjmcompany matsuoHMJM-055HMJM055h-172hmjm00055
    • 2021-04-30
    47 min

    FC2PPV 1795998 I was bullied by Lori’s face and tried to fuck

  • amateur uncensoredfc2
    • 2021-04-30
    57 min

    FC2PPV 1777219 [Limited quantity 2980pt → 1980pt] Beautiful busty Menes Miss Aya opened her own shop ❤️ White tank top covered with oil with transparent panties and defeated with purchase privilege

  • amateur uncensoredfc2
    • 2021-05-02
    120 min

    [AGR-034]The Filthy Wife In A Sailor Uniform Next Door Rieko Hiraoka

  • rieko hiraoka censoredcosplaymature womanAGRrubysusumu yanokuchigrace rubyAGR-034AGR034agr00034
    • 2021-05-22
    125 min

    [XTRM-004]Intense Throw Up Discipline Masochistic Girl Has The Back Of Her Throat Used As A Toilet Kaori Shimozono

  • shiorizono kaori censoredcreampiedeepthroatXTRMtoyohikozarakiseiunkai ekusutorimuXTRM-004XTRM004xtrm00004
    • 2021-06-08
    242 min

    [SDMM-092]Reverse One-Way Mirror Cab Part 7 - Unattainable Flight Attendant Edition - Have You Ever Seen An International Airline Stewardess Take It Raw？ She Cums Hard No Matter How Many People Could Be Watching! 4 Hours, 4 Girl Compilation

  • censoredamateurSDMMsod createafro takahashimagic mirrorSDMM-092SDMM0921sdmm00092
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-26
    74 min

    [XVSR-602]Masked Couples - Deceiving Women And Deceived Women - Chapter 2 Hibiki Otsuki

  • otsuki sound censoredcreampiedramaXVSRmax ak c takedacalenXVSR-602XVSR602xvsr00602
    • 2021-06-26
    64 min

    519MAZOF-004 [Big Breasts J Cup] Psychotherapist ♀ 29 years old [Human quit] Masochist pig Jcup big breasts therapist vaginal cum shot breeding. Brainwashing a perverted female doctor who feels treated as a meat urinal rather than normal love with a

  • amateur censoredcreampiebig titsmazofmazof-004mazof004519mazof-004
    • 2021-07-02
    166 min

    [SSIS-104]* Absolutely No Script!! POV Fuck! No Makeup! It's All Here! The True Dirty Nature Of Saki Okuda Is Revealed In This Exposed Fuck Session!! A Super Rare Film Of This Real Couple's Hot Spring Trip With Nonstop Fucking, Too Raw And Sh

  • saki okuda censoredbig titssingle workSSISs1 no 1 stylearashiyama michiruSSIS-104SSIS104ssis00104
    • 2021-07-13
    61 min

    508HYK-010 Ikeike Sister ＃ 10 Nene Ikeike Big Tits Gal Orgy

  • amateur censoredcreampiebig titshykhyk-010hyk010508hyk-010
    • 2021-07-14
    200 min

    [HUNTB-056]"I Missed My Last Train Home, Can You Put Me Up For The Night!？" I Was Working Overtime With My Two Super Naughty Co-Workers, And Then They Missed The Last Train Home. And Then They Suddenly Said That They Wanted To Spend The Night

  • censoredcreampieblowjobHUNTBhunterkawajirihhh groupHUNTB-056HUNTB056huntb00056
    • 2021-07-14
    134 min

    [GVH-262]Bossy Female CEO And Her Horny Stepson Mio Kimijima

  • kimishima mio censoredcreampiebig titsGVHglory questhyonGVH-262GVH26213gvh00262
    • 2021-07-23
    101 min

    [SQTE-377]Tease My Nipples, Touch Them, Lick Them, Pinch Them: Marina Saito

  • marina saito censoredsquirtinguniformSQTEs cuteSQTE-377SQTE377sqte00377
    • 2021-07-27
    118 min

    [MSFH-066]One Fine Summer Day, I Met With 2 Of My C***dhood Friends For The First Time In Years, And We Were Burning With Hot Passion ... While My Girlfriend Was Away, We Lived Together For 3 Days, Sweatily Hungering For Each Other Konomi Yoshinaga

  • yoshinaga konomi censoredsoloworkdramaMSFHsod createdragon nishikawams sodMSFH-066MSFH066
    • 2021-07-30
    101 min

    [YST-250]Mr Honma is my Master Yuri Honma

  • really censoredcreampiebig titsYSTkoyachoYST-250YST250540yst00250
    • 2021-08-16
    56 min

    230OREC-861 Bunny H

  • amateur censoredcreampieamateurorecorec-861orec861230orec-861
    • 2021-08-19
    152 min

    [JRZE-070]Entering The Biz At 50! Reiko Seo

  • reiko seo censoredcreampiemature womanJRZEcenter villageminami daichishoku ureJRZE-070JRZE070h-086jrze00070
    • 2021-09-03
    158 min

    [SHKD-962]The Woman From The Dating App. With Such A Woman, I"ll Absolutely Have To Fuck Her. Kozue Minami

  • minami kozue censoredsingle workSHKDattackersshi yoru akuSHKD-962SHKD962shkd00962
    • 2021-09-25
    239 min

    [OKAX-776]Amateur Seduction! How Far Will You Fuck While Wearing Masks Or The Plastic Wrap？ 240 Minutes.

  • censoredamateurhandjobOKAXk m producedick mandokuokazuOKAX-776OKAX776okax00776
    • 2021-10-01
    270 min

    [DVDMS-718]Escape From MM: Amateur Girl"s Friendship Project - Neat Married Woman"s Edition - Mom"s Friend SPECIAL Call Your Friend Within 30 Minutes To Take Her Place And Escape From The Locked Room! If You Don"t Escape Before The Ti

  • censoredcreampieamateurDVDMSdeepsking of genkingthe magic mirrorDVDMS-718DVDMS718dvdms00718
    • 2021-10-21
    93 min

    [MESU-089]Older Female Boss Overtime Fuck Creampie Office, Saeko Ikegami

  • saeko ikegami censoredcreampiemature womanMESUcenter villageshibuyared snowMESU-089MESU089h-086mesu00089
    • 2021-10-30
    140 min

    [SOAN-068]Naive Islander Sanshin Street Perfomer Has To Take Double Penetration In Her Round Ass For Cash... But Miss Kuran Herself Gives Assent With Her Desperate Cries. Itou Kuran

  • red orchid censoredsingle workbukkakeSOANyama to soratanizoko fu taroukoumon houmonSOAN-068SOAN068soan00068
    • 2021-11-05
    17 min

    FC2PPV 2404666 [Weekend Limited Release] Wife’s Daytime Cheating Video Robbed From Cheating Partner: Wife Who Refuses Even If She Asks For Sex Spills A Man’s Big Cock At Home [cen]

  • amateur uncensoredfc2
    • 2021-11-13
    120 min

    [KSBJ-166]A Secret Meeting on An Unsafe Day, My Younger Brother in Law"s Sperm Made me Pregnant...Kaho Imai

  • natsuho imai censoredcreampiebig titsKSBJksb kikaku emmanuellesakura ninKSBJ-166KSBJ166ksbj00166



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download