javcensored uniform censored slut




FC2WANZDASDMIDEAUKSSPRDSSISHDKASHKDWAAAFSDSSCHRVSQTEMARAMVSDCJODAWDNATRROYDMEYDHUNTB

2020-07-09
61 min

413INST-036 4P / Orgy Individual Shooting Ward Office Civil Servant Girl Sana-Chan 23 Years Old ♪ Slut Vs Beasts! Three Men Are Squeezed Out To The Extreme Jun Manko Who Became Sensitive To Oil. It Feels Too Good And Convulsions Ultra Acme!

  • amateur censoredcreampiebig titsinstinst-036inst036413inst-036
    • 2020-07-07
    72 min

    [TG-071][School PREMIUM Girls] Older Men Lick Where It's Dirty, So I Like Them - Slut Girl Likes Old Man Cocks

  • censoreduniformschoolgirlTG1059 tokyoTG-071TG071h-1304tg00071
    • 2020-06-12
    115 min

    [BANK-004]This Furiously Cute Shaved Pussy Beautiful Girl Is A Horny S********l Who Loves Creampie Sex Mana Hirade

  • hirate mana censoredcreampieuniformBANKpussy banktake chanBANK-004BANK004h-1495bank00004
    • 2020-06-11
    161 min

    [DASD-685]The No.1 Little Devil Girl In The Nation A Girl Who Will Lure You To Cowgirl Temptation

  • mitani akari censoredblowjobbeautiful girlDASDcenter villagenao masakidasDASD-685DASD685dasd00685
    • 2020-06-05
    115 min

    [PARATHD-2915]11 Ladies! Will The Nasty Big Titted Dental Assistant Let Me Fuck Her？ Special

  • censoredbig titsuniformPARATHDparadise tvPARATHD-2915PARATHD2915parathd02915
    • 2020-06-05
    60 min

    [PARATHD-2903]If We Order A Massage At A Business Hotel, Will The Lady Give Us Some Nookie？ (5) Sasaki-san Is Giving Me A Massage And Rubbing Just My Private Parts

  • censoreduniformamateurPARATHDparadise tvPARATHD-2903PARATHD2903parathd02903
    • 2020-05-28
    46 min

    [HHKL-036]"So You Don't Mind That Your First Time Is Going To Be With A Slut Like Me...？" I Confessed My Love For A Super Slut, And To My Surprise, She Reacted Super Naively, And That Got Me Excited, And I Couldn't Control Myself, And

  • censoredbig titsschoolgirlHHKLhuntercognac kaminohhh groupHHKL-036HHKL036hhkl00036
    • 2020-05-23
    160 min

    [CJOD-243]"I Told You That I've Already Cum..." I Had Already Ejaculated, But She Continued To Suck On My Sensually Sensitive Cock... Ichika Matsumoto

  • ichika matsumoto censoreduniformblowjobCJODslut havenichiro kanedaCJOD-243CJOD243cjod00243
    • 2020-05-17
    118 min

    [DDHH-012]Confinement - I Became A Shameful Slut For Men - Kanon Ichikawa

  • kanon ichikawa censoreduniformdeepthroatDDHHdogmahidekiDDHH-012DDHH012ddhh00012
    • 2020-05-15
    229 min

    [BAZX-232]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-232BAZX232h-1496bazx00232
    • 2020-05-13
    52 min

    345SIMM-424 Just an angel! Plump fair-skinned nurse also takes care of the lower body ♪ Whole body rubbing with slimy lotion and continuous vaginal cum shot sex!

  • amateur censoredcreampieuniformsimmsimm-424simm424345simm-424
    • 2020-05-09
    58 min

    345SIMM-422 In-hospital soap opened! ？？ A new nurse eats a patient with lotion play! "Do you want to do it until morning？" The third round of vaginal cum shot!

  • amateur censoredcreampieuniformsimmsimm-422simm422345simm-422
    • 2020-05-08
    158 min

    [YMDD-192]Erotic X-Ray Vision - I Discovered A Way To Instantly Transform My Shy Classmate Into A Sexy Slut! - Rui Hiiragi

  • scolding censoreduniformschoolgirlYMDDmomotaro video publishingtommy boywakaYMDD-192YMDD192ymdd00192
    • 2020-04-30
    61 min

    345SIMM-420 I Want To Get Fucked With A Teacher … "School Girls Who Have Been Promoted From A Student To A Physical Relationship"

  • amateur censoredcreampiebig titssimmsimm-420simm420345simm-420
    • 2020-04-23
    61 min

    345SIMM-416 [Erotic Gal J ● 4th person connecting beads] Carnivorous metamorphosis gal J ● and SEX who like aging odor! → Change into erotic costumes and take another round → "Introduce your friend’s erotic gal" → Next time, more erotic

  • amateur censoredcreampieuniformsimmsimm-416simm416345simm-416
    • 2020-04-22
    61 min

    345SIMM-415 [Erotic Gal J ● Third person connecting beads] De M Black Gal J ● is proud of her long tongue and pink nipples with G milk for plenty of service SEX… 3 barrage! → "Introduce your friend’s erotic gal" → Go to see Hina-chan (SI

  • amateur censoredcreampiebig titssimmsimm-415simm415345simm-415
    • 2020-04-17
    126 min

    [DDHH-011]Confinement -I'm A Men's Sex Slut Now- Himawari Nagisa

  • sunflower censoreddeepthroatsingle workDDHHdogmahidekiDDHH-011DDHH011ddhh00011
    • 2020-04-16
    221 min

    [HUNTA-761]"You Don't Mind Your First Time Being With A Slut Like Me...？" After I Confessed To A Totally Slutty Girl, Her Unexpectedly Naive Reaction Drove Me Wild With Desire!

  • censoredcreampieschoolgirlHUNTAhuntercognac kaminohhh groupHUNTA-761HUNTA761hunta00761
    • 2020-04-11
    196 min

    [MIRD-201]Beautiful Y********l Panty Shot Harem Hot Y********ls Love To Make Cocks Explode Akari Mitani Mitsuki Nagisa Miku Abeno

  • mitani akari scooping censoreduniformschoolgirlMIRDmoodyzdragon nishikawamoodyz realMIRD-201MIRD201mird00201
    • 2020-04-09
    174 min

    [NHDTB-387]She Was Hooked On His Slobbering Kisses Filled With Drool So Thick It Stretched Like Cobwebs

  • censoreduniformschoolgirlNHDTBnatural highlemonheart nakajimaNHDTB-387NHDTB3871nhdtb00387
    • 2020-04-04
    148 min

    [BF-605]The Truth Is, I've Been Undergoing Breaking In Training Every Day With The Middle-Aged Loser Who Lives Next Door Ichika Matsumoto

  • ichika matsumoto censoreduniformschoolgirlBFbefreeroku yonBF-605BF605bf00605
    • 2020-03-14
    148 min

    [AP-753]Black Tights S********l Squirting Slut

  • censoredsquirtingschoolgirlAPapachemasanorihhh groupAP-753AP753ap00753
    • 2020-03-08
    149 min

    [IPX-450]Hey Hey, Do You Want To Fuck？ Narumi Is A Beautiful Girl With Beautiful Legs, And Enjoying A Sexy School Life Narumi Hirose

  • narumi hirose censoredsquirtinguniformIPXidea pocketusa pyondishIPX-450IPX450ipx00450
    • 2020-02-29
    145 min

    [WANZ-933]Double Tattoo Gals - We'll Jerk Your Cock Off After School! - Sui Mizumori, Reira Hazuki

  • aoi mizumori hazuki leila censoredcreampieuniformWANZones factoryno directorwanzWANZ-933WANZ933wanz00933
    • 2020-02-13
    98 min

    [MILK-080]Even Demons Get Tears In Their Eyes - A Sadistic Woman Completely Falls For The Pleasure Of Wild Sex - Shizuku Kurosaki

  • shirosuku kurosaki censoredcreampieschoolgirlMILKmilkno directorMILK-080MILK080h-1240milk00080
    • 2020-02-06
    134 min

    [MILK-076]A Girl In A Sailor Uniform With A Sadistic Machine Gun Technique Punches, Kicks, And Dirty Talk Upper Cuts She's Totally Dominate Maso Men With Her Kansai Dialect Full Fucking Sex Aoi Kururugi

  • aoi kururugi censoredbeautiful girlslutMILKmilkaoi kurikiMILK-076MILK076h-1240milk00076
    • 2020-02-06
    461 min

    [NHDTB-367]Drooling, Slobbering Kissing Sex 3 This Slut S********l Will Lick The Shit Out Of A Dirty Old Man Until She Has Him Hooked Highlights 2-Disc Set

  • censoredschoolgirlslutNHDTBnatural highvanilla sakuraino labelNHDTB-367NHDTB3671nhdtb00367
    • 2020-02-01
    478 min

    [OFJE-232]Aika Yumeno Newest 13 Title Complete Collection 8 Hour Highlights

  • yumeno aika censoredbig titsuniformOFJEs1 no 1 styleno directorOFJE-232OFJE232ofje00232
    • 2020-01-19
    170 min

    [DASD-629]She'll Get You Hard Amd Treat You To A Smile. A Lolita Slut. Akari Akari Neo

  • akari neo censoredcreampieuniformDASDdashiromichi hoseDASD-629DASD629dasd00629
    • 2020-01-19
    152 min

    [CAWD-048]A Young Female S*****t Is Attracted To Lonely Older Men - She Seduces Them With Her Innocent Smile And Passionate Kisses That Make Their Knees Go Weak... - Male Teachers Enter A Forbidden Relationship With A Slutty S*****t - Akari Neo

  • akari neo censoreduniformschoolgirlCAWDkawaiibungo maedaCAWD-048CAWD048cawd00048
    • 2020-01-19
    127 min

    [DASD-627]She Scored No.1 On The Nationwide Standard Little Devil English Test A Girl In A School Uniform Who Will Lure You To Cowgirl Temptation Haruka Takami

  • haruka takami censoreduniformbeautiful girlDASDdasnao masakiDASD-627DASD627dasd00627
    • 2020-01-17
    125 min

    [GNAB-013]These S*********ls In Uniform Have A High Erotic Standard Deviation Score And During Their School Trip, They're Toying With The Teachers At The Hotel In A Panties-Snatching Face-Off Massive Fuck Fest Orgy Party!!

  • ayumi reika teranishi sayaka censoreduniformschoolgirlGNABprestigebang prestigeGNAB-013GNAB013118gnab00013
    • 2020-01-03
    115 min

    [ONEZ-219]I Won't Be Able To Resist My Loose Slut S*****t's Temptation MAKI vol. 001

  • maki censoredcreampieuniformONEZprestigetodoonezONEZ-219ONEZ219118onez00219
    • 2019-12-19
    163 min

    [HND-765]My Girlfriend Is Right Nearby, But She's Quietly Whispering Into My Ears And Trying To Lure Me To Creampie Temptation Nao Jinguji

  • jinguji temple nao censoredcreampieuniformHNDhon nakanao masakiHND-765HND765hnd00765
    • 2019-12-14
    118 min

    [MVSD-414]Breaking In Old Pigs! - Light-Skinned Gal Reira-chan Shows Off Her Incredible Sadistic Potential As She Teases Older Guys And Swallows Their Cum! - Reira Hazuki

  • hazuki leila censoredcreampieuniformMVSDm s video groupMVSD-414MVSD414mvsd00414
    • 2019-12-13
    125 min

    [GNAB-010]S*********ls in Uniform Panty Teasing vol. 2

  • kiriyama yuu natsuho imai censoreduniformschoolgirlGNABprestigebang prestigeGNAB-010GNAB010118gnab00010
    • 2019-12-08
    132 min

    [USAG-002]A Sick But Cute Girl "When I Get A Dick In My Pussy, That's When I Feel Alive" A Secretly Big Tits Amateur With A Secret Account Who Was Looking For Orgy Partners Online

  • censoredbig titsuniformUSAGrabbit daydreamersUSAG-002USAG002usag00002
    • 2019-12-08
    127 min

    [ARM-822]A Little Devil Temptation By An Intellectual Girl

  • chiharu miyazawa akemi miu censoredslutARMaroma planningkijin kasaiaromaARM-822ARM822arm00822
    • 2019-12-07
    160 min

    [MIAA-199]Dripping Saliva, Passionate Licking And Kissing - A Beautiful Young Slut In Uniform Takes Her Middle-Aged Teacher Captive With Seductive Tongue-Kissing - Kanon

  • kanon kanon censoreduniformschoolgirlMIAAmoodyzkurumi ichinoseeveryone s porn starMIAA-199MIAA199miaa00199
    • 2019-11-27
    57 min

    345SIMM-302 Sex monster awakening! ？？ J ● Slut playing with a man’s nipple

  • amateur censoredcreampiebig titssimmsimm-302simm302345simm-302
    • 2019-11-23
    119 min

    [MIAA-191]Begging Backdoor Piston Pumping Sex 2 A Horny Beautiful Young Babe In Uniform Who Will Lure You To An Erection With Panty Shot Temptation Yui Nagase

  • yui nagase censoreduniformbeautiful girlMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-191MIAA191miaa00191
    • 2019-11-15
    59 min

    [CLO-008]A Dirty Old Man And A Beautiful Young Slut In Uniform Suzuka

  • censoredblowjobbeautiful girlCLOchobitchchovicCLO-008CLO008h-1435clo00008
    • 2019-11-09
    120 min

    [MIAA-181]A Little Devil In Black Tights This Beautiful Young Girl In Uniform Kept On Luring Me To Temptation With Her Tight And Beautiful Legs In Silky Smooth Tights As She Guided Me To Ejaculation Mitsuki Nagisa

  • scooping censoredbeautiful girlslutMIAAmoody ssapporo taroeveryone s kikatanMIAA-181MIAA181miaa00181
    • 2019-11-07
    230 min

    [DANDY-689]Is My Little Sister Getting It On With Her Lesbian Classmate Next Door Neighbor!？ I Peeked Inside And Saw My Sister And Her Classmate Getting It On With Slut Action And Then They Fucked Me In A Double Blowjob/Double Handjob/Double Squirtin

  • censoredcreampieblowjobDANDYdandyparsley okamotoDANDY-689DANDY6891dandy00689
    • 2019-11-07
    60 min

    [SHN-018]A Dribbling, Drooling, Kissing Monster A Sexy Slut In Uniform Who Will Give You A Deep And Rich French Kiss And Hug You With A Smile

  • censoreduniformschoolgirlSHNnatural highvanilla sakuraispecially selected nachu girlsSHN-018SHN0181shn00018
    • 2019-10-18
    123 min

    [GNAB-004]Uniform Girl Panties Provocation At The Student Council - J Cup Girl Sluttily Seduces Her Virgin Teacher And Turns Him Into A Masochist

  • hirakawa kotona tojo censoredschoolgirlslutGNABprestigebang prestigeGNAB-004GNAB004118gnab00004
    • 2019-10-12
    240 min

    [HUNTA-671]"I've Become Such A Slut... Are You Disillusioned？" Childhood Friends Climaxing Like Crazy! They See Each Other For The First Time In A While, And She Looks The Same As She Used To, But At The Front...

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-671HUNTA671hunta00671
    • 2019-09-12
    139 min

    [SDMU-946]"Hello Teacher, I'm Cumming Over To Fuck You." A Slut Schoolgirl Who Teases Her Teacher Every Day And Controls His Ejaculations Until His Maso Lust Blossoms Hikaru Minazuki

  • hikaru minazuki censoredslutsingle workSDMUsod createkomatsu 17SDMU-946SDMU9461sdmu00946



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download