javcensored pov censored jav various worker




FC2NATRRBDHDKAMIDEGMEMSTARSVENXVEMAPREDSSNINACRSSISSPRDFSDSSKBICJODBBANMIDVNGODMVSD

2021-01-05
74 min

FC2PPV 1628013 [3-day limited sale] [No] Night practice with a sick swordsman in bed ♥ “Please give me a drink ♥” [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-08
    55 min

    [tkwa-149]もね

  • amateur censoredamateurtkwatkwa-149tkwa149tkwa-149
    • 2021-01-10
    300 min

    [DVAJ-496]The Girl I Love Stolen Right In Front Of My Eyes

  • kawakami nanami freedom censoredcreampieDVAJalice japansagi kandaDVAJ-496DVAJ496dvaj00496
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-21
    170 min

    [DANDY-746]Ass-Shaking Cowgirl Sex While Restraining A Man With A Boner. An Esthetician With A Beautiful Ass Milks Men Dry In A Massage Parlor vol. 3

  • nana maeno kiyoshi maihara censoredslutDANDYdandybacon tanakaDANDY-746DANDY7461dandy00746
    • 2021-01-23
    123 min

    [JUL-447]Casual Hot Springs Adultery: Since You Won't Look At Me... I Had Another Man Embrace Me. Suzu Monami

  • monami bell censoredsingle workJULmadonnabieber gonzoJUL-447JUL447jul00447
    • 2021-01-27
    50 min

    230OREC-677 Nene

  • amateur censoredcreampiebig titsorecorec-677orec677orec-677
    • 2021-01-29
    78 min

    FC2PPV 1664684 [SSS] [First Press Limited 1980] Cool beauty sister advent! ❤️ Former reader model with a tall slender beauty body and rich contact ❤️ Raw blowjob ❤️ Raw Saddle ❤️ Plenty of raw vaginal cum shot in the cramped pussy of the former model

  • amateur uncensoredfc2
    • 2021-01-29
    48 min

    [fan-103]ちはる

  • amateur censoredamateurfanfan-103fan103fan-103
    • 2021-02-12
    120 min

    [EBOD-801]It Took One Whole Year To Persuade Her To Do Porn - The No. 1-Ranked Soapland Hooker In Kanazawa - Real Life H-Cup Brothel Babe's Porn Debut Noa Mochizuki

  • mochizuki censoredbig titsblowjobEBODe bodymon cEBOD-801EBOD801ebod00801
    • 2021-02-12
    84 min

    [DORI-012]Fuck Video No.12 "I Want You To Stick Your Raw Cock Into Me!" This Spoiled J* Is Opening Up Her Legs And Begging For Sex And She Was So Adorable That I Gave Her 2 Creampie Fucks!

  • censoredcreampieschoolgirlDORIfirst starsucking shootingDORI-012DORI012h-491dori00012
    • 2021-02-19
    85 min

    FC2PPV 1693035 [Amateur / Concafe clerk] Leaked Gonzo Private photo session of holiday layer Massive vaginal cum shot in 20-year-old beautiful girl pussy (with high-quality SEX data)

  • amateur uncensoredfc2
    • 2021-02-19
    74 min

    [OTIM-057](For Streaming Editions) (Daydream POV Fantasies) A Shameful Maid Who Will Fuck On Her Ovulation Day Tsumugi Narita

  • narita tsumugi censoredcreampieblowjobOTIMprestigeonetimeOTIM-057OTIM057118otim00057
    • 2021-02-21
    44 min

    FC2PPV 1696467 ★ First shot amateur ☆ Super fine ♥ Petcha small breasts Lori daughter Oriai 19 years old ☆ Sensitive pussy blamed for the first squirting ♥ Iki rolled Lori daughter mercilessly raw squirrel ~ first cum shot with momentum ♥ [Personal s

  • amateur uncensoredfc2
    • 2021-02-22
    118 min

    [GENM-072]The Ultimate Beautiful Girl Will Lure You To Temptation At This Outdoor Warehouse 2 Amy Fukada

  • emi fukada censoredbeautiful girlslutGENMgenekig 3GENM-072GENM072genm00072
    • 2021-02-25
    220 min

    [DANDY-752]"I'm An Old Lady, But I'm Going To Get Serious Now" Alone, With A Part-Time Boy For An Hour, During Their Break! This Part-Time Working Beautiful Old Lady Had Forgotten How It Felt To Be A Woman, But Now That She's With

  • censoredcreampiemature womanDANDYdandykikujiro otsuDANDY-752DANDY7521dandy00752
    • 2021-02-26
    39 min

    FC2PPV 1703109 Infiltrate a secret orgy ㉖ Super milk beyond huge breasts! K cup boobs swaying with Brun Brun ♥ Uncles are also excited and can not stand it and vaginal cum shot one after another ♪ * High quality version & review benefits included

  • amateur uncensoredfc2
    • 2021-03-12
    216 min

    [BAZX-278]POV Sex With A Beautiful Girl In Sailor Uniform vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-278BAZX278h-1496bazx00278
    • 2021-04-15
    240 min

    [OKAX-724]Field Guide To Married Blowjobs - 54 Wives, 4 Hours - Their Tongue Techniques Feel So Good You'll Blow Your Load Right Inside Their Mouths

  • censoredmarried womanblowjobOKAXkm produceferrino urayaside dishesOKAX-724OKAX724okax00724
    • 2021-04-15
    130 min

    [JRZE-041]First Time Filming My Affair: Aya Kasuga

  • kasuga aya censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-041JRZE041h-086jrze00041
    • 2021-04-18
    240 min

    [BRTM-024]Infinite Cumming: Tied Up And Fully Restrained Female Bodies

  • censoredBRTMkm produceblack realBRTM-024BRTM024brtm00024
    • 2021-04-18
    131 min

    [ANZD-075]Pure Amateur Babes Get Horny For Wild Fucks After A Little Liquor!

  • censoredamateurANZDanzu daydream vacationanzuANZD-075ANZD075anzd00075
    • 2021-04-24
    161 min

    [TNOZ-004]Titty From Colossal 40" Knockers - Cosplayer, Age 19, Big Tits (5-Some Orgy, 11 Loads) Nipple Orgasms And Deep Throat Face Fucking, Creampie Sex, Screaming Orgasms, Breaking In A Slut Endlessly...

  • censoredbig titscosplayTNOZall japan amateur photographers union daspit uncle 2 all japan kameko cooperatiTNOZ-004TNOZ004tnoz00004
    • 2021-04-24
    145 min

    [LULU-070]My Plain Jane Big Tits Office Lady Colleague's Nickname Is "The Thirty-Something Girl In Glasses", But I Had No Idea That She Had Such Sensual Nipples And Enjoyed Having Perverted Nipple Sex ...! Miku Maina

  • maina miku censoredcreampiebig titsLULUlunaticsvagmanLULU-070LULU070lulu00070
    • 2021-04-29
    51 min

    H4610 gol205 Natsuki Kuramoto 21years old

  • amateur uncensoredh4610
    • 2021-05-01
    120 min

    [SSIS-051]Giving A Woman With An Amazing Ripe Body Aphrodisiacs And Having Enhanced Sex Full Of Orgasms And Incontinence Saki Okuda

  • saki okuda censoredbig titsmature womanSSISs1 no 1 stylemon cSSIS-051SSIS051ssis00051
    • 2021-05-01
    36 min

    210AKO-426 RIONA

  • amateur censoredsquirtingamateurakoako-426ako426210ako-426
    • 2021-05-08
    208 min

    [BAZX-289]The Creampie Idol Sleeps Her Way To The Top vol. 015

  • censoredcreampieuniformBAZXbazookatodoBAZX-289BAZX289bazx00289
    • 2021-05-11
    205 min

    [SDJS-118]This Cutie Used To Be An Idol In Her S*****t Days - She Even Made A Hit Sex Tape! Now Her Super Sensitive Body Is On Display As One Of Our Exclusive Employees! 4 Full Fucks - From Her Adorable Looks You'd Never Guess Her Astounding Erot

  • komatsu rui censoredamateursingle workSDJSsod createakira saijosod female employeeSDJS-118SDJS1181sdjs00118
    • 2021-05-19
    127 min

    [GVH-234]Obstinate Female CEO With A Slutty Body And Her Perverted Step Son Yui Hatano

  • yui hatano censoredcreampiebig titsGVHglory questhyonGVH-234GVH23413gvh00234
    • 2021-06-01
    57 min

    H4610 ki210601 Miki Ide 30years old

  • amateur uncensoredh4610
    • 2021-06-19
    119 min

    [CAWD-232]Her 19-Year-Old Body's Still Developing - Ririi Sena - 2-Orgasm Special

  • lily sena censoredsquirtingbeautiful girlCAWDkawaiitake dCAWD-232CAWD232cawd00232
    • 2021-06-20
    124 min

    [OPKT-030]Forbidden Pregnancy OK: Creampie Part-time Job - Sara Tsujimiya

  • tsujimiya sara censoredcreampieslutOPKTtoyohikotoyohikotoyohiko kikakuOPKT-030OPKT030opkt00030
    • 2021-06-24
    61 min

    1Pondo 062421_001 Home visit sexual intercourse with a teacher Rino Sakuragi

  • amateur uncensored1pondo
    • 2021-06-26
    79 min

    [DANDAN-002]She Can Never Say No! Nurse With H-Cup Tits Devotedly Services Her Patients With Titty Fucking Miss Aimi

  • censoredbig titsblowjobDANDANdandytanaka baconDANDAN-002DANDAN0021dandan00002
    • 2021-07-02
    83 min

    483SGK-031 [Unprecedented Ikippa] [Eros bare IT company OL] [Gakuburu endless cum] [Iku if inserted! Transcendental sensitive constitution] [Eloy woman who makes a man stubborn] I was waiting for such a woman! If you insert it, it’s cool! Iku wi

  • itol censoredamateursgksgk-031sgk031483sgk-031
    • 2021-07-18
    132 min

    [HOMA-107]My Wife's Sister Boldly Tempts Me and Makes a Cuckold of My Wife. Ayane Sezaki.

  • ayane sezaki censoredslutsingle workHOMAh m p doramajo asagiriHOMA-107HOMA107homa00107
    • 2021-07-23
    160 min

    [LULU-088]When Her Young Male Employees Don't Perform, She Hits Them With A 3-Step Subjugation Program Featuring Demonic Pull Out Teasing, Handjob Tweaking, And Nipple And Anal Domination Meet A Voluptuous Horny Lady Boss With Big Tits Who Will S

  • really censoredcreampiebig titsLULUlunaticsvagmanLULU-088LULU088lulu00088
    • 2021-07-30
    93 min

    300NTK-613 [Pecan! !! 3 Beautiful Girls! !! All Innocent Bitch! !! Gangbang "6P" Special! !! ] Exactly Sake Pond Meat Forest! !! Beautiful Girl X 3 People! !! All The Miraculous Three Sexes Called De Nasty Dovich Gather Under The Clear Sky An

  • amateur censoredcreampiesquirtingntkntk-613ntk613300ntk-613
    • 2021-07-31
    58 min

    Pacopacomama 073121_509 She Got A Sex Toy In Her Vagina: Cute And Sophisticated Looking Wife Is So Horny! Hitomi Okano

  • amateur uncensoredpacopacomama
    • 2021-08-04
    130 min

    [GVH-268]Celebrity Public Training: Karina Nishida

  • nishida karina censoredanalsingle workGVHglory questtorindoru tanakaGVH-268GVH26813gvh00268
    • 2021-08-06
    152 min

    [IPX-707]「生はダメ！気持ち良すぎるから！すぐイクってばぁ！」 絶頂後にぶっちぎりの追撃生中出しピストン 桜空もも

  • sakura sky momo censoredcreampiebig titsIPXidea pocketkyouseitissueIPX-707IPX707ipx00707
    • 2021-08-13
    120 min

    [SSIS-147]"Sorry Dear..." For The 7 Days That My Husband Was On A Business Trip, My Husband"s Boss That I Hate Fucked Me Like Crazy... Yura Kano

  • yura kanno censoredsingle workSSISs1 no 1 styleasagiri jouSSIS-147SSIS147ssis00147
    • 2021-08-22
    98 min

    300NTK-626 [Indecent G Breast Nippon Representative Class Boyne Beauty JD & Slender International Student And Throat 4p Special! !! ] Powerful Big Pie That Jumps Out Of Cosplay! !! Reason Collapses On A Sizzle-Filled Nipple! !! Big Explosion! !! W

  • amateur censoredcreampiebig titsntkntk-626ntk626300ntk-626
    • 2021-08-30
    50 min

    292MY-473 Misa Koide 1

  • amateur censoredbig titsmarried womanmymy-473my473292my-473
    • 2021-09-16
    68 min

    10musume 091621_01 I’ve Reached A Lot Of Orgasms Today Keiko Eto

  • amateur uncensored10musume
    • 2021-09-24
    125 min

    [CLDG-009]The Miracle I-cup Godly Tits Of This C***dcare Worker - Chizuru Shiina

  • chizuru shiina censoredcreampiebig titsCLDGtoyohikotoyohikotoyohiko kikakuCLDG-009CLDG009cldg00009
    • 2021-09-24
    111 min

    [WZEN-049]Banned 02: Life Insurance Salesperson Keiko (26)

  • censoredcreampiesquirtingWZENwaap entertainmentnaomiWZEN-049WZEN0492wzen00049



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download