javcensored planning high vision big cock jav




FC2NGODGVHJUFECESDAUKGAMBIADNMVSDMILKSTARSMIAAPPPDAWDNACXCAWDHMNAUKGVENXKBICHRV

2020-12-10
67 min

SIRO-4334 [First shot] [Anime voice x Ahe face] [Bare libido] Exotic-looking sexy English conversation teacher’s foolery. If you play with the M body that is too sensitive, you scream an obscene line with an anime voice with a gap .. AV applicat

  • amateur censoredamateursirosiro-4334siro4334siro-4334
    • 2020-12-10
    52 min

    230OREC-650 Non

  • amateur censoredcreampieschoolgirlorecorec-650orec650orec-650
    • 2020-12-19
    62 min

    Caribbeancom 121920-001 The Gorgeous Sexy Body Induces Vulgar Erections! Mio Kuroki

  • mio kuroki uncensoredcreampiehandjobcaribbeancom
    • 2020-12-21
    120 min

    [KSAT-027]A Personal Documentary! A Big Tits Wife Engages In Bodily Fluid-Secreting Aphrodisiac-Laced Mind-Blowing Sex Mayumi 30 Years Old

  • censoredcreampiebig titsKSATstrong woman s table daydream tribesix mantable of a strong womanKSAT-027KSAT027ksat00027
    • 2020-12-22
    140 min

    [STARS-309]Practicing Making Babies With My C***dhood Friend - Creampie Sex. Suzu Honjo

  • suzu honjo censoredcreampiesingle workSTARSsod creategoemonsod starSTARS-309STARS3091stars00309
    • 2020-12-22
    39 min

    279UTSU-473 Kyokasan

  • amateur censoredcreampiemarried womanutsuutsu-473utsu473279utsu-473
    • 2020-12-31
    717 min

    [OFJE-291](First-Time Buyers Only) Limited Edition Original Dust Cover - First Fuck Of 2021 - 100 Gorgeous Porn Stars Packed Into The Ultimate New Years Gift Bag - All Sex, 12-Hour Special

  • yuma asami asuka kirara censoredbig titsblowjobOFJEs1 no 1 styleOFJE-291OFJE291ofje00291
    • 2021-01-05
    38 min

    233BAT-085 Ayane

  • amateur censoredamateurbatbat-085bat085233bat-085
    • 2021-01-12
    82 min

    [LOOTA-033]Lolita - Karen Junshin

  • innocent karen censoredsingle workLOOTAsupa kubijonLOOTA-033LOOTA0335433loota00033
    • 2021-01-24
    111 min

    [AGMX-070]Nipple-Licking Sixty-Nine

  • yuki s shiina noa censoredslutAGMXsex agent daydreamersdaibutsu yoshidasex agentAGMX-070AGMX070agmx00070
    • 2021-01-26
    66 min

    SIRO-4401 [First shot] [Naive F dairy student] [First time in my life ..] An active professional student who wants to play with curiosity ahead. She has never done a joint party, but she is interested .. AV application on the net → AV experience shoo

  • amateur censoredbig titsamateursirosiro-4401siro4401siro-4401
    • 2021-01-28
    60 min

    H0930 ki210128 Saeko Hamaoka 28years old

  • amateur uncensoredh0930
    • 2021-02-02
    63 min

    HEYZO 2451 Discrete Maid Is Ready For Naughty Care Vol.12 – Miyu Ono

  • miyu ono uncensoredcreampieheyzo
    • 2021-02-02
    60 min

    [KBTV-060]"Actually, I'm Worried My Cock Is Too Big" If We Confessed To Being Hung, Would A Girl's Curiosity And Maternal Instinct Get The Better Of Her？ We Find Out

  • censoredamateurKBTVmessy tvKBTV-060KBTV060h-1514kbtv00060
    • 2021-02-05
    50 min

    396BIG-073 Ayatsu (28)

  • amateur censoredcreampiebig titsbigbig-073big073396big-073
    • 2021-02-27
    160 min

    [WAAA-035]My Big Sister-In-Law Hates My Guts, But I Just Happened To Run Into Her, Working At A Soapland. And Now I Can Have All The Sex I Want, And I'm Going To Make Her Service Me In Style And Creampie Fuck Her, Over And Over Again! Honoka Tsuj

  • tsujii honoka censoredcreampiebig titsWAAAwanz factorywanzWAAA-035WAAA035waaa00035
    • 2021-03-01
    243 min

    [NACX-073]Legendary Beautiful Mature Women, 12 People, BEST vol. 02

  • shota chisato yu kawakami morino morino censoredcreampiebig titsNACXplanet plusshichidomeNACX-073NACX073h-237nacx00073
    • 2021-03-01
    302 min

    [DOKS-536]Long Sexy Tongue Blowjob Best Selection 11 Girls Who Love To Suck Cock 5 Hours

  • natsume atago rena kitamura censoredblowjobslutDOKSoffice k sDOKS-536DOKS53636doks00536
    • 2021-03-02
    35 min

    318LADY-364 Misaki

  • amateur censoredamateurladylady-364lady364318lady-364
    • 2021-03-06
    48 min

    371AHSHIRO-175 Yuki / Shinohara couple / Matsushima / Mizutani couple

  • amateur censoredbig titsamateurahshiroahshiro-175ahshiro175371ahshiro-175
    • 2021-03-21
    65 min

    476MLA-029 [I cup huge breasts] Ginza hostess is a tide splash! !! A devilish woman who contributes 800,000 brand bags to a large customer is incontinent ⇒ Pride collapses! Demon Pis climax where the Sui Cup rotates at high speed like an amusement pa

  • amateur censoredsquirtingamateurmlamla-029mla029476mla-029
    • 2021-03-28
    44 min

    330PER-379 Nanami

  • amateur censoredbig titsuniformperper-379per379330per-379
    • 2021-04-01
    120 min

    [NACR-412]Sex With A Married Woman Carrying Breast Milk, Impatient At Her Abstinence - Hinami Narisawa

  • hinami narusawa censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-412NACR412h-237nacr00412
    • 2021-04-09
    122 min

    [UMD-773]I Lost My Virginity To My Step Aunt 11

  • kiyoshi maihara tsukasa nagano censoredbig titsslutUMDleodragon nishikawaUMD-773UMD773125umd00773
    • 2021-04-23
    177 min

    [MIDE-917]Intimate, Loving Newly Wed Lifestyle - Come Home Every Day To An Adorable Wife Trying To Seduce You... Nana Yagi

  • nana yagi censoredblowjobbeautiful girlMIDEmoodyzusa pyonmoodyz divaMIDE-917MIDE917mide00917
    • 2021-05-02
    240 min

    [SITW-036]Go To Sex Campaign Multinational Impregnation Trip Fucking Beautiful Foreign Amateurs From Around The World

  • alex harper audrey royal censoredcreampieSITWspartan delusional familyspartanSITW-036SITW036sitw00036
    • 2021-06-06
    46 min

    188HINT-0463 Misa

  • amateur censoredcreampiemarried womanhinthint-0463hint0463188hint-0463
    • 2021-06-19
    238 min

    [NPJB-059]Tokyo Halo Girl: Total Uniformed Girls Declaration: 4 Hours, 20 Works

  • censoredcreampiebig titsNPJBnanpa japanNPJB-059NPJB059npjb00059
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-26
    120 min

    [KSBJ-143]And Then, I Stopped Being Satisfied With My Husband... Chitose Shinohara

  • chitose shinohara censoredcreampiebig titsKSBJksb kikaku emmanuellebito sakuraKSBJ-143KSBJ143ksbj00143
    • 2021-08-27
    129 min

    [BANK-051]Busty Wife Hot Spring Date, H Cup Misato Wants To Be Turned Into A Slut, 25 Years Old

  • censoredcreampiebig titsBANKma ko ginkoutakechanBANK-051BANK051h-1495bank00051
    • 2021-08-30
    41 min

    292MY-474 Misa Koide 2

  • amateur censoredcreampiebig titsmymy-474my474292my-474
    • 2021-08-31
    103 min

    261ARA-504 [Osabori Ol] [Mask Beauty] Sakura-Chan Is Here! !! The Reason For Applying For A Beautiful Girl Is "I Want To Suck My Cock ♪" I Skipped Work And Came To AV Shooting ♪ I’M Too Embarrassed To Remove The Mask To The Last Minute!

  • amateur censoredamateuraraara-504ara504261ara-504
    • 2021-09-04
    292 min

    [HOIZ-023]Cum Cum Punch 15 Amateur Cum Cum Action / A Fuck Buddy / A Beautiful Girl / A Private Video Session / A Hookup App / POV / Amateur / Social Media / Underground Account / Cum Face / Beautiful Tits / Big Tits / Neat And Clean / Tall / Beautif

  • censoredbig titsamateurHOIZshirouto hoihoi mousozokuHOIZ-023HOIZ023hoiz00023
    • 2021-09-04
    30 min

    FC2PPV 2149435 [Interview] A Serious F-Cup 19-Year-Old Active Jd Who Has Just Graduated. 2 Barrages Even Though It Is An Interview

  • amateur uncensoredfc2
    • 2021-09-05
    55 min

    233BAT-093 Mikako

  • amateur censoredcreampieamateurbatbat-093bat093233bat-093
    • 2021-09-09
    161 min

    [MIST-347]Right On Ovulation Day!! A Soapland Where You Can Make Babies 31 Kurea Hasumi

  • hasumi claire censoredbig titssingle workMISTmr michirusaitaMIST-347MIST3471mist00347
    • 2021-09-09
    60 min

    SIRO-4623 [First Shot] [Small Devil Cowgirl] [Blow Job] An Innocent New Esthetician Who Laughs Cheerfully. A Carnivorous Girl Who Seems To Be Pure, Flirts With Her Cock While Rushing And Shakes Her Hips As If Tossing A Man .. Application Amateur, Fir

  • amateur censoredamateursirosiro-4623siro4623siro-4623
    • 2021-09-11
    159 min

    [XRLE-018]Married Woman Erupts From Anal Daydream. Anal Exploration. Hazuki-san (Alias) 25 Years Old. Moe Hazuki

  • moe hazuki censoredanalcreampieXRLEk m producesugino kireal real worksXRLE-018XRLE018xrle00018
    • 2021-09-16
    55 min

    Pacopacomama 091621_532 Cum On Tits Special: Hiromi Hashimoto, Hiromi Hashimoto, Maki Sekiguchi

  • amateur uncensoredpacopacomama
    • 2021-09-17
    123 min

    [JJBK-047]Mature Woman Babes Only A Mature Woman Came To My Room For Takeout Sex I Filmed Peeping Footage And Now I"m Selling It As An AV 45 A Step Nephew Who Receives Immoral Treatment From His Step Auntie Slut Minami-san / I-Cup Titties / 44 Ye

  • censoredslutJJBKjukujo bank emmanuelgroupJJBK-047JJBK047jjbk00047
    • 2021-09-28
    93 min

    261ARA-506 [Ikegal] [Spear Rolling] Iroha-Chan Is Here! !! Sex Is A Daily Occurrence! !! The Reason For Her Application Is "I Want To Roll Up With A Professional Cock Www" You Can Tell By Looking At The Maximum Exposure As A Hami Butt ♪ [Gats

  • amateur censoredamateuraraara-506ara506261ara-506
    • 2021-10-01
    120 min

    [CAWD-291]Passionate Sex And Creampie With A S********l 20 Years My Junior, Starring Asuka Hanahara

  • hanahara asuka censoredcreampieuniformCAWDkawaiikimura hiroyukiCAWD-291CAWD291cawd00291
    • 2021-10-22
    119 min

    [JUL-750]A Popular And Slender, Exclusive Actress Her First Appearance In The Series Of Shame!! She"d Rather Die Than Fuck Him, But He Made Her Cum Like Crazy ... Ann Komatsu

  • anzu komatsu censoredmature womansingle workJULmadonnaasagiri jouJUL-750JUL750jul00750
    • 2021-10-23
    243 min

    [MCSR-457]At My Favorite Bar... Lewd Sex Dirty Talk WIth Beautiful Hostess, and Sopping Wet Pussy 4 Hour-Special. Erotic Hostess 10 People!

  • censoredmature womanMCSRbigmorkalkamejima saburoumasukattoMCSR-457MCSR45757mcsr00457
    • 2021-11-02
    53 min

    188HINT-0487 Yue

  • amateur censoredcreampiemarried womanhinthint-0487hint0487188hint-0487
    • 2021-11-06
    121 min

    [MDTM-745]Complete POV Sailor Prostituting. I Love My Teacher Nana Hayami

  • don t be quick censoredcreampieuniformMDTMk m producetodouchuu kikakuMDTM-745MDTM745mdtm00745
    • 2021-11-25
    101 min

    [FERA-129]Fucking One"s Beautiful Stepmother to Fulfill a Pregnancy Fetish, and Experiencing French Kisses and an Explosion of Sweat. Yuri Fukayama

  • yuri miyama censoredcreampiemature womanFERAcenter villageminatoyarakuenFERA-129FERA129h-086fera00129



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download