javcensored maid jav high vision censored




FC2MIAAAVSAPREDHMNSSNINATRFSDSSCHRVMILKRBDDASDATIDSHKDHDKAAWDKBIHUNTBHNDMARAIPX

2020-07-24
118 min

[WANZ-967]She's Giving Out Cowgirl Hospitality But She's Cumming Too! It Feels So Good She Keeps On Cumming Out Of Control As She Pounds That Pussy Faster And Faster And Shakes Her Ass So Hard That She Can't Control Herself!! Amy Fukada

  • emi fukada censoredcreampiesingle workWANZwanz factorywanzWANZ-967WANZ967wanz00967
    • 2020-07-24
    117 min

    [MIAA-276]Amy Fukada Is Giving Out Excessively Horny Hospitality Cherry Popping Sex She's Showing Up In A Maid Outfit In This Suddenly Ejaculating Documentary!

  • emi fukada censoredcreampiebig titsMIAAmoodyzzampaeveryone s porn starMIAA-276MIAA276miaa00276
    • 2020-07-11
    117 min

    [MIDE-797]Finally 18 And Ready To Fuck! This Maid Gives The Best Service You've Ever Seen Rikka Ono

  • rokka ono censoredblowjobbeautiful girlMIDEmoodyzkyoseimoodyz divaMIDE-797MIDE797mide00797
    • 2020-07-09
    116 min

    [FGAN-020]He's Getting An Unexpected Erection Full-On Panties A Beautiful Girl Saki Saki Shida

  • saki shida censoredsingle workFGANfetish eyesFGAN-020FGAN020h-1440fgan00020
    • 2020-07-03
    120 min

    [ONEZ-244]A Disturbed Maid Who Loves Her Master Too Much Is Full Of Hospitality Ichika Matsumoto vol. 004

  • ichika matsumoto censoredcreampieblowjobONEZprestigetodoonezONEZ-244ONEZ244118onez00244
    • 2020-06-25
    110 min

    [GS-339]I Ordered A Home Delivery Service Special (A Massage Therapist, A Maid, A Computer Repair Specialist), And Was Thinking That I Would Either Get A Creepy Guy Or An Old Lady, But Instead ... I Got A Beautiful Big Tits Girl! A Hot Girl!! A Super

  • censoredbig titsGSsosoru x garconona pGS-339GS3391gs00339
    • 2020-06-16
    140 min

    [STARS-255]Hey, Your Dick Is Still So Hard Consecutive Blowjob Action With Recently Ejaculated Sensual Cocks Yuzu Shirakawa

  • yuzu shirakawa censoredblowjobbeautiful girlSTARSsod createkurumi ichinosesod starSTARS-255STARS2551stars00255
    • 2020-06-14
    150 min

    [PPPD-854]110cm Marshmallow Colossal J-Cup Tits With Pink Nipples - A Maid Gets Creampied And Does A Follow-Up Titty Fuck - Ria Chitose

  • chitose ria censoredcreampiebig titsPPPDoppaiPPPD-854PPPD854pppd00854
    • 2020-06-12
    139 min

    [BAMA-003]Mix Of 5 Full Fucks From Barely Legal Young Beauty's Ecstasy

  • mari rika ai kawana censoredsisterBAMAbaltanspilma boyBAMA-003BAMA003bama00003
    • 2020-06-12
    113 min

    [VRTM-504]"I Came And Cleaned Up That Old Man's House And Made It Nice And Tidy..." This Y********l Was Full Of Innocence And Purity And Wanted To Make Some Money So She Cleaned House While Wearing A School Swimsuit And Knee-High Socks An

  • kanon kanon kiyoshi saki censoredcreampieVRTMe bodygoro koenjiv r produceVRTM-504VRTM504h-910vrtm00504
    • 2020-06-11
    179 min

    [MIDE-785]Sensitive Service Maid Cums Instantly: Nana Yagi

  • nana yagi censoredblowjobbeautiful girlMIDEceleb no tomokyoseimoodyz divaMIDE-785MIDE785mide00785
    • 2020-06-11
    111 min

    [FGAN-018]The Panties Fetish Appreciation Society Kanna Kanna Shiraishi

  • shiraishi plane censoredsingle workFGANradixfetish eyesFGAN-018FGAN018h-1440fgan00018
    • 2020-06-05
    120 min

    [ONEZ-241]This Maid Is Klutzy And Dopey But She's Got Big Tits And Loves To Suck Dick Tsugumi Morimoto

  • tsugumi morimoto censoredcreampiebig titsONEZprestigetodoonezONEZ-241ONEZ241118onez00241
    • 2020-05-30
    119 min

    [MIDE-779]She's Ready To Immediately Suck Dick And Quickie Fuck The Total Domain Of A Shameful Maid Mizuki Aiga

  • mizuki ai censoredsquirtingsingle workMIDEmoodyzmoodyz divaMIDE-779MIDE779mide00779
    • 2020-05-24
    120 min

    [GENM-042]My Master Is My Pet Spanking My Maid's Ass Haruka Takami

  • haruka takami censoredbeautiful girlslutGENMgenekigr 3GENM-042GENM042genm00042
    • 2020-05-23
    156 min

    [MISM-175]Double Anal Cum Crazy Sex An Obedient Anal Maid Collection Mihina Yukina Sakurami

  • mihina azumihina mihina nagai yukina sakurami censoredanaldeepthroatMISMm girls labinaballMISM-175MISM175mism00175
    • 2020-05-17
    120 min

    [AQSH-057]A Married Woman Flesh Fantasy Maid My Wife Received Breaking In Training And Was Turned Into A Creampie Pet By An Erotic Novelist Tsugumi Morimoto

  • tsugumi morimoto censoredcreampiemature womanAQSHaquamall herowhite moleaquamallAQSH-057AQSH057aqsh00057
    • 2020-05-17
    99 min

    [TIKB-079][Certified Divine Gal] This Naughty Maid Gal Is Tall And Has A Knockout Body These Divine Videos Show Her Going Cum Crazy For Rock Hard Cocks Belonging To Perverted Dirty Old Men! Elle Sato

  • sato l censoredcreampiesingle workTIKBtikitiki.comerTIKB-079TIKB079tikb00079
    • 2020-05-07
    239 min

    [CADV-762]My Very Own Shameful Maid Big Tits Edition 8 Ladies 4 Hours

  • kirishima sakura yoshinaga akane censoredbig titsCADVcrystal eizocrystal exCADV-762CADV76249cadv00762
    • 2020-05-02
    167 min

    [PRTD-027]I'm A Maid, And While My Master Was Away For A Month, His Home Was Taken Over, And Now, I'm To Be Fucked Every Day, Until I Become Pregnant... Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlPRTDpremiumgory matsutathe strong and noble beautiesPRTD-027PRTD027prtd00027
    • 2020-05-01
    120 min

    [ONEZ-237]Obsessed Maid's Service For Her Beloved Master Ria Misaka vol. 003

  • misaka ria censoredcreampieblowjobONEZprestigetodoonezONEZ-237ONEZ237118onez00237
    • 2020-05-01
    124 min

    [HDKA-209]The Naked Maid: Nude Maid Agency: Hikaru Ikuno

  • hikaru ikuno censoredcreampiebig titsHDKAplanet plusdirector orafu shukoHDKA-209HDKA209h-237hdka00209
    • 2020-04-25
    147 min

    [WANZ-957]If You Come I Will Piston Fuck You Faster! Fucking A Maid With Plump Big Ass From Behind!! Kanon Kanade

  • kanon kanon censoredsingle workWANZones factorywanzWANZ-957WANZ957wanz00957
    • 2020-04-25
    120 min

    [MIAA-269]She Twists His Sensitive Cock Just As He's About To Cum, And Gets Sticky-Fingered In Multiple Orgasmic Action! This Maid Loves To Lick Cocks, And She Sure Knows How To Clean Rei Kuruki

  • satoshi kuruki censoredblowjobbeautiful girlMIAAmoodyzgoemoneveryone s porn starMIAA-269MIAA269miaa00269
    • 2020-04-24
    62 min

    [OTIM-020](For Streaming Editions) (Daydream POV) An Obedient And Incredibly Beautiful And Sexy Maid With An Excessively Erotic Body Is Providing Instant Cum Swallowing Pleasure & Creampie Raw Footage Hospitality At A High-Class Hotel Tsugumi Mori

  • tsugumi morimoto censoredcreampieblowjobOTIMprestigeno directorone timeOTIM-020OTIM020118otim00020
    • 2020-04-19
    117 min

    [JUL-200]Only For Me!! Obedient Married Woman Creampie Maid Is Totally Obedient To Old Man's Orders. Fertilization Training Every Day. Ai Mukai

  • ai mukai censoredcreampiemature womanJULmadonnarokusaburo mishimaJUL-200JUL200jul00200
    • 2020-04-17
    52 min

    [ETQR-130]Immediate Quickie With The Maid! Shiori Mochida

  • yuri mochida censoredcreampieblowjobETQRerotic timeETQR-130ETQR130h-1186etqr00130
    • 2020-04-17
    120 min

    [EMH-004]Squirt! An Older Woman Who Had A Secret Meeting in Tokyo's Kita-ward, Akabane.

  • censoredcreampiebig titsEMHold maid emmanuelleno directorEMH-004EMH004emh00004
    • 2020-04-17
    51 min

    [ETQR-131]Immediate Quickie With The Maid! Lianna Yutsuki

  • uzuki liana censoredcreampieblowjobETQRerotic timeETQR-131ETQR131h-1186etqr00131
    • 2020-04-17
    47 min

    [ETQR-129]Immediate Quickie With The Maid! Nozomi Arimura

  • arimura nozomi censoredcreampieblowjobETQRerotic timeETQR-129ETQR129h-1186etqr00129
    • 2020-04-11
    119 min

    [MIAA-254]30 Days Of Abstinence A Gal Maid Is Confronted With 20 C*cks In A Huge Orgy, And Begs For Creampies Kaho Imai

  • natsuho imai censoredcreampiesingle workMIAAmoodyzkogoro kindaichieveryone s porn starMIAA-254MIAA254miaa00254
    • 2020-04-11
    146 min

    [DASD-659]Lewd Maids Were Given Creampies And Brought To Climax In A Highly Concentrated 0 Seconds When Time Was Stopped. Natsuki Kisaragi, Rika Yamamoto

  • natsuki kisaragi yamamoto renka censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-659DASD659dasd00659
    • 2020-04-11
    146 min

    [IPX-455]I Want You To Show Me Your Shameful Panties H H

  • yume nishinomiya censoreduniformbeautiful girlIPXidea pocketichigoharadishIPX-455IPX455ipx00455
    • 2020-04-04
    119 min

    [SSNI-749]I'm Slowly And Surely Developing This Obedient Maid Trainee Into My Kind Of Woman Over Several Days Of Breaking In Training Riko Shiraha

  • riko shirahaba censoredsquirtingsingle workSSNIs1 no 1 stylezaku araiSSNI-749SSNI749ssni00749
    • 2020-04-04
    149 min

    [PRTD-026]A Pregnancy Fetish G*******g With An Obedient Maid We Took Over This Elegant Family And Put Them Through Creampie Hell Yui Nagase

  • yui nagase censoredcreampiebeautiful girlPRTDpremiumkogoro kindaichithe strong and noble beautiesPRTD-026PRTD026prtd00026
    • 2020-04-03
    120 min

    [ONEZ-232]My Very Own Personal Maid Who Speaks In The Super Cute Hiroshima Dialect Hina Nanase

  • hina nanase censoredcreampieblowjobONEZprestigetodoonezONEZ-232ONEZ232118onez00232
    • 2020-04-02
    133 min

    [EKDV-624]My Private Maid Miku Abeno

  • miku abe censoredbeautiful girlsingle workEKDVcrystal eizokumataro morinoe kissEKDV-624EKDV62449ekdv00624
    • 2020-04-01
    120 min

    [HDKA-204]Naked Housekeepers: The Nude Maid Referral Agency: Kanon Kanade

  • kanon kanon censoredcreampieblowjobHDKAplanet plusdirector orafu shukoHDKA-204HDKA204h-237hdka00204
    • 2020-03-28
    120 min

    [BSTC-041]「あっ、そこはダメです、ご主人様…」可愛いメイド喫茶店員がAV出演！ 3P凌●責めによだれ垂れ流し連続イキ！

  • censoredcreampiebeautiful girlBSTCboston clubBSTC-041BSTC041h-1117bstc00041
    • 2020-03-27
    56 min

    [OTIM-019](Online Only) (Daydream Fantasy) The Loving Service Of A Super Cute But Crazy Maid: Ria Misaka

  • misaka ria censoredcreampieblowjobOTIMprestigeone timeOTIM-019OTIM019118otim00019
    • 2020-03-13
    146 min

    [XRW-843]It's Judgment Time!! A Live-In Beautiful Mature Woman Maid Is Seeing How Abnormal Her New Family Is Kanna Shinozaki

  • kina shinozaki censoredcreampiebig titsXRWreal workshideki hormonreal real worksXRW-843XRW843172xrw00843
    • 2020-03-06
    120 min

    [ONEZ-228]A Sexy MILF With Big Tits - Do You Like Maids？ - Nao Yuuki vol. 001

  • naoki yuuki censoredcreampieblowjobONEZprestigetodoonezONEZ-228ONEZ228118onez00228
    • 2020-03-05
    120 min

    [ATID-403]In Order To Protect Her Family, She Started Working As A Maid For A Filthy Rich Motherfucker Hikari Ninomiya

  • hikari ninomiya censoredcreampiesingle workATIDattackerskitorune kawaguchiin madATID-403ATID403atid00403
    • 2020-03-05
    177 min

    [OYC-311]This Super Plain Jane Beautiful Maid Was Getting Relentless Attention Towards Her Nipples From The Manager For Days On End, Until One Day, She Began To Desire His Attention, As She Could Feel Her Nipples Throbbing With Lust...

  • censoredcreampiebig titsOYCoyashoku.companysleggerhhh groupOYC-311OYC311oyc00311
    • 2020-03-05
    119 min

    [SSNI-723]Super Instant Techniques For Reinvigorating A Sensual Cock Immediately After Ejaculation! The Follow-Up Blowjob Maid Nodoka Sakuraba

  • sakuraha nodoka censoredbig titsblowjobSSNIs 1 number one stylecomet akais1 no 1 styleSSNI-723SSNI723ssni00723
    • 2020-02-29
    151 min

    [MIDE-741]A Maid Who Provides Sexual Services From Morning Until Night - Yui Shirasaka

  • yui shirasaka censoredsquirtingblowjobMIDEmoodyzusa pyonmoodyz divaMIDE-741MIDE741mide00741
    • 2020-02-29
    167 min

    [MIAA-232]A Sensitive Maid Has Screaming Sex! - Every Time She Cums, She Gets Fucked Even Harder - Mitsuki Nagisa

  • scooping censoredbeautiful girlsingle workMIAAmoody swild sevenkikatan for everyoneMIAA-232MIAA232miaa00232
    • 2020-02-28
    59 min

    [OTIM-017]Digital Exclusive - POV Daydream - A Cute Maid With A Hiroshima Accent - Hina Nanase

  • hina nanase censoredcreampieblowjobOTIMprestigeno directorone timeOTIM-017OTIM017118otim00017



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download