javcensored leg fetish jav censored




FC2SSISMIDVSSNIAPODDTTSQTEWAAAMARAMIDEHNDPREDAWDVENUHMNMVSDMEYDGMEMBLKHUNTBPPPD

2019-11-08
122 min

[VRTM-463]These Sales Ladies In Black Pantyhose Bow Their Heads To Apologize, Leaving Their Big Asses Vulnerable! - They Get Fucked And Creampied To Hell And Back!

  • ririka nanako miyamura censoredcreampieVRTMv r produceyoshida oliveVRTM-463VRTM463h-910vrtm00463
    • 2019-11-07
    184 min

    [NHDTB-338]Panties Drenched As Molesters Bring Women With Beautiful Legs To Orgasm By Fingering Them Inside Their Pantyhose 3

  • censoredsquirtingNHDTBnatural highkansukeNHDTB-338NHDTB3381nhdtb00338
    • 2019-11-03
    150 min

    [KTB-026]I've Got Pants Too! - Bukkake - OL Suits Club 15 - College Girl Intern Kanon-san Shows Off Her Favorite Miniskirt And A Sexy Pant Suit - Kanon Nakajou

  • nakajo canon censoredsingle workbukkakeKTBkahanshin tigers mousouzokukahanshin tigersKTB-026KTB026ktb00026
    • 2019-11-03
    120 min

    [KCDA-266]Beautiful Legs In A Pantyhose - Perverted Office Lady KCDA- 266

  • censoredbig titsKCDAdigital arkdigital ark digital arkKCDA-266KCDA266kcda00266
    • 2019-10-27
    110 min

    [EVIS-283]Pantyhose Girl's Arousing Dirty Talk and Masturbation

  • momose yuri aya miyazaki censoredslutEVISebisusan mousouzokugoro koenjiEVIS-283EVIS283evis00283
    • 2019-10-24
    233 min

    [SVDVD-755]The Magic Mirror Number Bus Hard Boiled We Asked Hard-Working Ladies To Wear These Stockings That Sparkle When Wet, So That We Can Get A Good Look At Their Beautiful Legs! And As Things Got More Exciting, We Plied Them With Money For Big D

  • censoredcreampieSVDVDsadistic villagenew kage kazamaSVDVD-755SVDVD7551svdvd00755
    • 2019-10-20
    108 min

    [ARM-806]Miki Sunohara x Tight Miniskirt Thick Ultimate Plan

  • future sunohara censoredcosplaysingle workARMaroma planningshigeo kadowakiaromaARM-806ARM806arm00806
    • 2019-10-13
    138 min

    [TIKB-057]God Specs: I Gave Aphrodisiacs To A 180cm Slender-Legged Super-Stylish Gal And She Let Me Fuck Her Without A Rubber - Elle Sato

  • sato l censoredcreampiesingle workTIKBtikitiki.comerTIKB-057TIKB057tikb00057
    • 2019-10-07
    106 min

    [DPMI-043]Race Queen Lovers Sumire Kurokawa

  • sumire kurokawa censoredsingle workDPMImiludopamixDPMI-043DPMI043dpmi00043
    • 2019-09-28
    116 min

    [JBJB-007]日焼けした純真スポーツ女子はオジさんのザーメン搾り取って大量潮吹きと数えきれない激イキ！ 神谷充希

  • mitsuki kamiya censoredsquirtingsingle workJBJBsharkjabujab townJBJB-007JBJB007h-687jbjb00007
    • 2019-09-14
    191 min

    [GDHH-167]My Stepsister Gives Me A Footjob! My Dad Remarried And Suddenly I Got A Cute Young Stepsister! Not Only That, But She Gives Off A Super Sexy Aura Showing Off Her Bare Legs And Panties...

  • censoredschoolgirlsisterGDHHgolden timekiteretsuhhh groupGDHH-167GDHH167gdhh00167
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453
    • 2019-09-13
    77 min

    [KWP-004]See-through 20 Denier Pantyhose Woman With Hot Legs Saryu Usui

  • sakisui censoredsingle workKWPk westk westpanty fuckingKWP-004KWP004h-1339kwp00004
    • 2019-09-13
    119 min

    [VRTM-450]This Sales Lady Suddenly Came Over, And When She Took Some Aphrodisiacs, She Started Rubbing Her Black Pantyhose Up Against Me, And Dripping With Lust, And Then She Locked Her Legs Around Me And Demanded Creampie Sex! SPECIAL Toka Rinne &am

  • roaring sound anne mashiro censoredcreampieuniformVRTMv r producegoro koenjiVRTM-450VRTM450h-910vrtm00450
    • 2019-09-13
    136 min

    [ZMEN-026]Defenseless Female Boss Taking Off Her Pantyhose Gets Raging Hard Cock From Behind! He Can't Stand It And Cums Right Away! Then Cums Again After They're Back On!! 2

  • risa mochizuki arisa miyagawa censoredZMENz mengoro koenjiZMEN-026ZMEN026h-1371zmen00026
    • 2019-09-09
    129 min

    [BAVC-002]Sexual Gratification Sumire Is Inviting Emotion With Her Plump Butt: Sumire Kurokawa

  • sumire kurokawa censoredsingle workBAVCbaltanspilma boyvictoriaBAVC-002BAVC002bavc00002
    • 2019-09-09
    113 min

    [DPMI-042]Fuck Queen - Maria Nagai

  • maria nagai censoredcreampiesingle workDPMImiludopamixDPMI-042DPMI042dpmi00042
    • 2019-09-08
    118 min

    [ARM-794]Strong Desire For Beautiful Legs: I Want To Finish Off On Your Bare-Skinned Legs

  • kanae lennon sumire kurokawa censoredARMaroma planninghamu oujiaromaARM-794ARM794arm00794
    • 2019-09-06
    485 min

    [TRE-113]Raw Creampie Sex Best Hits Collection Vol.03 When Your Hot Sperm Drips Down The Walls Of Her Pussy, Flowing Out From Her Womb, She's Guaranteed To Be Pregnant!!!

  • censoredcreampiebig titsTREprestigemichiru santreasureTRE-113TRE113118tre00113
    • 2019-09-06
    188 min

    [ABP-895]Maria Aine Is So Erotic And Cute, She's Practically A Living Cheat Code, And Now She's Luring You To Full-Force Temptation In 5 Dream-Cum-True Situations Maria Aine Will Use Every Trick In Her Book To Lure You To Temptation!!

  • maria aine censoredcosplaysingle workABPprestigemy brother akiraabsolutely perfectABP-895ABP895118abp00895
    • 2019-09-06
    115 min

    [ESK-310]Escalating Super Amateur Girl 310 Nene-chan 20 Years Old

  • censoredamateurESKprestigedamashiyaESK-310ESK310118esk00310
    • 2019-09-05
    157 min

    [SSNI-560]Total Domain Tall Girl Flashes Her Sexy Legs - A Nympho In Knee Highs Hotaru Nogi

  • nogi firefly censoredschoolgirlsingle workSSNIs1 no 1 stylegoemonSSNI-560SSNI560ssni00560
    • 2019-09-01
    132 min

    [GOJU-119]The Wet Pantyhose Of A Mature Woman - Kana Shiokawa

  • kana suruga censoredblowjobmature womanGOJUfifty somethingGOJU-119GOJU119h-1165goju00119
    • 2019-08-23
    105 min

    [XRW-739]A Voluptuous Elder Sister In A Competitive Swimsuit Gets Her Thighs Assaulted By A Maso Man

  • himari ogawa yukina midwinter censoredXRWreal worksreal real worksXRW-739XRW739172xrw00739
    • 2019-08-17
    140 min

    [AES-002]The Sex Slave Pantyhose Banquet Yui Hatano Rika Mari Arisa Hanyu

  • yui hatano mari rika censoredbig titsslutAESaegea daydreamersgoro koenjiAES-002AES002aes00002
    • 2019-08-11
    117 min

    [DPMI-041]Campaign Girl Crazy Legs Sarina Kurokawa

  • sarina kurokawa censoredsingle workDPMImiludopamixDPMI-041DPMI041dpmi00041
    • 2019-08-03
    116 min

    [PRED-173]A True Love Sex Encounter Between An Older Sister In A Tight Skirt, And Me Who Only Managed To Pluck Up My Courage Once - Yume Sasaki

  • yume sasaki censoredcreampiesingle workPREDpremiumtake delegancePRED-173PRED173pred00173
    • 2019-07-27
    123 min

    [FNEO-032]My Boyfriend Is Practically A Shut-In, So He Never Fucks Me, But My Big Brother-In-Law Is Also Living With Us, And Thanks To Him, My Unfulfilled Life Was Changed Forever... A Female Student With Beautiful Legs Enjoys The Pleasures Of Being

  • one thousand three bells censoredbdsmsingle workFNEOfirst starbirdman teppeifirst star neoFNEO-032FNEO032h-491fneo00032
    • 2019-07-14
    124 min

    [MGMJ-038]Beautiful Legs In Pantyhose Runa Shimotsuki

  • shimotsuki runa censoredslutsingle workMGMJmegamibeautiful goddess fetishMGMJ-038MGMJ038mgmj00038
    • 2019-07-12
    151 min

    [ZMEN-019]When I Saw This Cabin Attendant Totally Unguarded In Her Pantyhose For The First Time, I Got Super Excited! Her Beautiful Legs Were My Favorite, And They Were So Erotic That I Splattered Her With My Hot Bukkake Cum Without Her Permission To

  • nanako miyamura kanae lennon censoreduniformZMENz mengoro koenjiZMEN-019ZMEN019h-1371zmen00019
    • 2019-07-12
    120 min

    [VRTM-438]This Saleswoman Suddenly Came To My House, And After Drinking Some Aphrodisiacs, She Started Rubbing Her Black Pantyhose Against Me, And Then Her Pussy Began Dripping With Lust, And Finally She Locked Me Tight With Her Legs And Demanded Cre

  • ririka rina oumi censoredcreampieuniformVRTMv r produceeightVRTM-438VRTM438h-910vrtm00438
    • 2019-07-12
    76 min

    [KWP-003]Black Tights A 30-Denier Yarn Peachy Ass Barely Legal Babe Shiori Kuraki

  • kuraki bookmark censoredbeautiful girlsingle workKWPk westk westKWP-003KWP003h-1339kwp00003
    • 2019-07-11
    150 min

    [MANE-038]Life As The Neighborhood Gimp - Broken In By The Woman Across The Street... Miori Ayaha

  • ayaba miori censoredsingle workMANEakinorishurikenmaneaterMANE-038MANE0381mane00038
    • 2019-07-08
    109 min

    [ARM-779]Her Young Thighs Milk Middle-Aged Balls Dry. Thigh-Job By A Girl 20 Years Younger Than Me.

  • miho yui satori fujinami censoredschoolgirlslutARMaroma planningaromaARM-779ARM779arm00779
    • 2019-07-01
    123 min

    [CLOT-004]Pantyhose Business Woman Nao Ito

  • makoto ito censoredcreampiehandjobCLOTplanet plusbirdman teppeicloseCLOT-004CLOT004h-237clot00004
    • 2019-06-29
    204 min

    [CLUB-565]Flight Attendants With Long Beautiful Legs Using Their Employee Massage Service: Get It Harder and Faster Than They Were Expecting

  • censoredCLUBhentai shinshi clubCLUB-565CLUB565club00565
    • 2019-06-15
    173 min

    [SSNI-497]Devilish Beautiful Legged Female Teacher Always Tempts Me With Her Pantyhose Even Though She's A New Hire Arina Hashimoto

  • there is hashimoto censoredslutsingle workSSNIs1 no 1 stylexavier thomasSSNI-497SSNI497ssni00497
    • 2019-06-15
    118 min

    [ZEX-373]Beautiful Legs Hot Ass MAX AIKA

  • aika censoredsingle workZEXpeters maxhideki hormonZEX-373ZEX373h-720zex00373
    • 2019-06-14
    129 min

    [XRW-706]Beautiful Legs Pantyhoseism 03 Yui Tomita

  • yu tomita censoredsingle workXRWreal worksreal real worksXRW-706XRW706172xrw00706
    • 2019-06-09
    118 min

    [DPMI-039]Unreal Panty Hose Legs Manami Oura

  • manami oura censoredsingle workDPMImiludopamixDPMI-039DPMI039dpmi00039
    • 2019-06-03
    64 min

    [KWP-002]Her Sexy Ass In 20-Denier See-Through Pantyhose Mao Hamasaki

  • hamazaki mao censoredsingle workKWPk westk westpsKWP-002KWP002h-1339kwp00002
    • 2019-05-31
    240 min

    [OKAX-507]The Naughty Chiropractic Massage Parlor Where Office Ladies From Yaesu, Ikebukuro And Shinjuku Squirm With Pleasure. 4 Hours

  • censoredOKAXk m producedick mandokuokazuOKAX-507OKAX50784okax00507
    • 2019-05-17
    103 min

    [XRW-685]My Teacher And I Share An After School Classroom Secret... Mirei Aika

  • aika mirei censoredcreampieblowjobXRWreal worksreal real worksXRW-685XRW685172xrw00685
    • 2019-05-17
    181 min

    [ABP-858]Sex OK!？ The Underground Massage Parlor Everyone Is Talking About 09. Sex In A Small Booth. The Tall Woman And Her Beautiful Legs Will Definitely Turn You On. Riona Mana

  • mana rio censoredsingle workABPprestigemasaru pantherabsolutely perfectABP-858ABP858118abp00858
    • 2019-05-08
    123 min

    [ARM-762]Panty Shot And Footjob Pleasure R*pe Collection

  • yu tomita yuki sakuragi censoredARMaroma planningaromaARM-762ARM762arm00762
    • 2019-04-26
    55 min

    [KWP-001]Bubble Butt Babe In 20 Denier Transparent Pantyhose Asahi Mizuno

  • mizuno chaoyang censoredsingle workKWPk westk westpsKWP-001KWP001h-1339kwp00001
    • 2019-04-22
    357 min

    [DMOW-189]I Got Fucked While She Talked Dirty To Me. 6 Hours

  • ichika kamihata mikimoto nozomi censoredblowjobslutDMOWoffice k smowDMOW-189DMOW18936dmow00189
    • 2019-04-14
    125 min

    [MGMQ-035]When A Girlfriend Rapes Her Man An Office Lady Co-Worker With Beautiful Legs Turns The Tables On Her Man In Reverse Man-Woman Sex Lenon Kanae

  • kanae lennon censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-035MGMQ035mgmq00035



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download