javcensored high vision pantyhose tights censored creampie




FC2NATRMEYDEBODSTARSAPODDASDSANAUKGGMEMAWDSSNIWAAASPRDSHKDMVSDMARASDABBBANNACRMIDE

2020-11-19
52 min

H4610 ki201119 Kokoro Kirikawa 26years old

  • amateur uncensoredh4610
    • 2020-11-22
    164 min

    [CAWD-147]Sex With You Tall Girl Taking 30 Creampie Cumshots Teacher Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesingle workCAWDkawaiiCAWD-147CAWD147cawd00147
    • 2020-12-04
    128 min

    [ABW-030]Godly Orgasms 2nd All Real Tied Up Climax Hell Maria Aine

  • maria aine censoreddeepthroatsingle workABWprestigeshiko tissue fuwafuwaabsolutely wonderfulABW-030ABW030118abw00030
    • 2020-12-10
    123 min

    [MEKO-197]Married Woman Who Took A High Paying Part Time Job As A Nude Art Model Fucked And Filled With Cum 30

  • censoredcreampieamateurMEKOmilf laboMEKO-197MEKO197h-1160meko00197
    • 2020-12-11
    58 min

    230ORETD-814 MITSUHA

  • amateur censoredcreampieuniformoretdoretd-814oretd814oretd-814
    • 2020-12-13
    104 min

    [BADA-009]Addicted To Adultery - Wife (28) Can't Slake Her Cheating Lust Yumina Hirosaki

  • yumina hirosaki censoredmarried womanblowjobBADAvartanyoshida great buddhadiamondBADA-009BADA009bada00009
    • 2020-12-15
    481 min

    [PYM-361]Her Lust Is Exploding, Anytime, Anywhere 40 Ladies 8 Hours Peeping Masturbation Videos

  • censoredamateurPYMprimoPYM-361PYM361h-283pym00361
    • 2020-12-15
    138 min

    [STARS-308]They Heard Their S*****t Teacher Was Hung - Doting Four-Some With A Trio Of Hot S********ls

  • hikari aozora natsume hibiki censoredschoolgirlSTARSsod createusa pyonsod starSTARS-308STARS3081stars00308
    • 2020-12-25
    99 min

    300MIUM-664 Infinite convulsions “Oni de M” gal! !! !! [SSS class gal with a high facial deviation value with a drinker! !! !! ] × [The highest erotic potential! !! !! Transcendental sensitive constitution & metamorphosis faucet Ma ● Th

  • amateur censoredamateurmiummium-664mium664300mium-664
    • 2021-01-27
    26 min

    FC2PPV 1662044 Limited to 3 days [Individual shooting] A housewife with a gambling addiction is pressed down by two men and vaginal cum shot is made with another stick.

  • amateur uncensoredfc2
    • 2021-01-29
    120 min

    [NEM-052]Stepmom's Ass Pull Out In Full View: Family Fun 1 Chisato Shoda

  • shota chisato censoredcreampiebig titsNEMglobal media entertainmentkikujiro akabanenewmomNEM-052NEM052143nem00052
    • 2021-02-03
    55 min

    345SIMM-603 Sex as soon as my father goes out! A young mother-in-law and her son seek each other like lovers at home alone …

  • amateur censoredcreampiebig titssimmsimm-603simm603345simm-603
    • 2021-02-06
    84 min

    383REIW-041 Aya

  • amateur censoredcreampieamateurreiwreiw-041reiw041383reiw-041
    • 2021-02-09
    83 min

    200GANA-2434 Seriously Nampa, first shot. 1595 Successful Picking Up A Gentle Erotic Gal Who Forgives Even If You Do Nani! Her erotic desire exploded, she actively shakes her hips while playing with chestnuts and cramps her body!

  • amateur censoredbig titssquirtingganagana-2434gana2434200gana-2434
    • 2021-02-11
    40 min

    [ore-752]サリナ

  • amateur censoredcreampiebig titsoreore-752ore752ore-752
    • 2021-02-12
    134 min

    [HONB-206]3 Gals Do Anything You Want

  • censoredamateurHONBmercurythe first shibuya special f e headquarHONB-206HONB206h-1133honb00206
    • 2021-02-12
    81 min

    259LUXU-1379 Luxury TV 1365 Nasty! Outstanding proportions beauty likes the previous play and applies for re-appearance herself! Keeping the indecentness that captivates a man … The attitude of service that arouses the man’s heart is also w

  • amateur censoredamateurluxuluxu-1379luxu1379259luxu-1379
    • 2021-02-22
    115 min

    [PRBYB-071]Instinctive Nude H[

  • censoredbig titsbeautiful girlPRBYBintec incPRBYB-071PRBYB071h-706prbyb00071
    • 2021-02-26
    64 min

    [MASE-014]Horny Older Woman 32 Year Old Nozomi Has Her Plump White Body Filled With Cum As She's Fucked Standing From Behind Twice! Nozomi Haneda

  • nozomi haneda censoredcreampiebig titsMASEcrystal picturemadam maniac plusMASE-014MASE01449mase00014
    • 2021-02-26
    39 min

    FC2PPV 1702827 First shot [Uncensored / Individual shot] Super serious JD plays uniform with his first daddy activity! Forced vaginal cum shot! * Immediate deletion of body

  • amateur uncensoredfc2
    • 2021-03-06
    122 min

    [NKKD-197]Housewife Sweetly Wrapping A Younger Horny Guy Up In Her Freshly Worn Underwear And Milking Him Dry - Ka Ayano Fuji

  • ayano kato censoredbig titsmature womanNKKDjet eizomanji groupNKKD-197NKKD197nkkd00197
    • 2021-03-08
    38 min

    [ore-761]Kana

  • amateur censoredcreampieschoolgirloreore-761ore761ore-761
    • 2021-03-15
    44 min

    492MERC-250 Brown Girl

  • amateur censoredschoolgirlamateurmercmerc-250merc250492merc-250
    • 2021-03-15
    41 min

    492MERC-247 Anal Sex At The Garbage Mansion 2

  • amateur censoredcreampieschoolgirlmercmerc-247merc247492merc-247
    • 2021-03-18
    130 min

    [RKI-607]New Bucketloads of Bukkake Eimi Fukuda

  • emi fukada censoredcreampiebig titsRKIrookieRKI-607RKI607rki00607
    • 2021-03-19
    231 min

    [SORA-301]This Crazy Exhibitionist JK Is A Dirty Talk Genius And Loves To Show Off, And She Said, "I'll Let You Fuck Me If We Do It Outdoors," And I'm A Normal Guy, But She Kept Working Me Up Until I Got A Maso Erection, And Then I Ex

  • mai takeda censoredslutsingle workSORAyama to soratelephone poleSORA-301SORA301sora00301
    • 2021-04-02
    91 min

    380SQB-095 Shou

  • amateur censoredamateurbeautiful girlsqbsqb-095sqb095380sqb-095
    • 2021-04-08
    160 min

    [HAWA-244]寝取らせ願望のある男が浮気した妻を 罰として他人に抱かせたら アナルまで開発されてしまった話

  • censoredHAWAkosumosu eizoumountain moricosmospictures soft on demandHAWA-244HAWA2441hawa00244
    • 2021-04-09
    121 min

    [IPX-648]My Teacher Miss Kijima Shakes Her Hips Sweetly And Smiles As She Seduces And Fucks Younger Men Airi Kijima

  • airi kijima censoredslutsingle workIPXidea pocketdishIPX-648IPX648ipx00648
    • 2021-04-15
    149 min

    [KTKC-113]"You Deserve To Nail A Girl With Big Tits" Exciting Discovery: Adorable Submissive Cutie With Short Hair Takes Off Her Clothes To Reveal Massive G-Cup Marshmallow Tits Ayaka

  • censoredbig titsamateurKTKCkitixx mousouzokujizo pokochinbig titsKTKC-113KTKC113ktkc00113
    • 2021-04-23
    164 min

    [WAAA-052]Your Girlfriend's Little Sister (Plain Jane, Shy And Seemingly Uninterested In Sex) Is Having Sex With You And Cumming So Hard That You Transformed Her Into A Creampie Cum Bucket Runa Tsukino

  • tsukino luna censoredcreampieblowjobWAAAwanz factorywanzWAAA-052WAAA052waaa00052
    • 2021-04-24
    51 min

    [OSST-011]My Korean Girlfriend Is Pure, Innocent, And Totally Natural! This Beauty's Never Been Under A Knife, And She Seems Really Easy To Get Into The Bedroom？!

  • censoredamateurOSSTpatzkin amateurbooker tulchan amateurOSST-011OSST011h-1450osst00011
    • 2021-04-27
    137 min

    [KNMB-012]Totally Raw [email protected] #A Gal Who Cums Too Much #Blonde And Cute #A Nice Personality #Her First Creampie On Camera #Check Out Her Fuck Face (LOL) #Successful Rough-Riding Creampie Sex #Her First Raw Pay-For-Play Fuck #Simple De

  • riria hido censoredcreampiebeautiful girlKNMBfirst star100 raw styleKNMB-012KNMB012h-491knmb00012
    • 2021-05-09
    56 min

    FC2PPV 1804900 [56 minutes 6 shots] Nowadays again. Uncut Creampie Cum ＃ 8

  • amateur uncensoredfc2
    • 2021-05-11
    62 min

    499NDH-016 An exotic beauty therapist with a neat appearance and more than 3 digits of experience pulls out all the sperm of a virgin! Blow, vagina, raw vaginal cum shot! The number of experienced people is not bad! Gently … sometimes violently

  • amateur censoredcreampieamateurndhndh-016ndh016499ndh-016
    • 2021-05-22
    131 min

    [KATU-082]Slutty Pub Owner With Erect Nipples Plump Nympho Amazon Goddess With Huge Tits And Ass

  • censoredbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-082KATU082katu00082
    • 2021-06-04
    147 min

    [NKKD-209]Wife Wraps Younger Boy's Cock In Her Freshly Disrobed Panties And Jerks Him Off Riho Fujimori

  • riho fujimori censoredbig titsslutNKKDjet eizomanji groupNKKD-209NKKD209nkkd00209
    • 2021-06-06
    89 min

    413INST-128 [Individual shooting / outflow] Complete appearance! Sentence Spring is also surprised Active idol secret intense vaginal cum shot Saka / Ja ○ couple’s date Saddle shooting The whole story!

  • amateur censoredcreampiebig titsinstinst-128inst128413inst-128
    • 2021-06-10
    133 min

    [IENF-146]Picking Up Real Amateur Wives - Would You Help Wash A Male Virgin's Stuck Foreskin？ It's Been Ages Since She's Seen A Hard Cock, So She's Ecstatic To Break Him In!

  • aichi michiru yamamoto renka censoredcreampiebig titsIENFienergytiger kosakaiienfIENF-146IENF1461ienf00146
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-26
    148 min

    [HUSR-237]I Love Male Body Fluids!! This Real Beauty Is Slutty And Perverted! Sweaty Sex With A Celebrity-Grade Beauty!

  • roxy rocket tear blonde censoredbig titsamateurHUSRbig morkalbooker thussleHUSR-237HUSR23757husr00237
    • 2021-07-02
    67 min

    230OREC-819 Aoi sensei

  • amateur censoredcreampieamateurorecorec-819orec819230orec-819
    • 2021-07-10
    150 min

    [APKH-179]Creampie Love Hotel "Please, Don't Pull Out! Cum Inside Me!" Riko Shinohara

  • riko shinohara censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-179APKH179apkh00179
    • 2021-07-17
    97 min

    [OAE-210]Youth And Short Hair. Iroha Shirazaki.

  • iroha shirasaki censoredsingle workOAEaircontrolOAE-210OAE210oae00210
    • 2021-07-24
    240 min

    [BDSR-455]Married Women's Cowgirls - 36 Horny Wives, 4 Hours

  • yu kawakami morino morino suzukiririka censoredbig titsmarried womanBDSRbig mocalmecates takedaBDSR-455BDSR45557bdsr00455
    • 2021-08-24
    42 min

    508HYK-012 Ikeike Sister ＃ 12 Nene 2 Ikeike Sister Personal Shooting

  • amateur censoredcreampiebig titshykhyk-012hyk012508hyk-012
    • 2021-08-26
    121 min

    [RCTD-419]The Queen"s Wrestling Ring, Vol. 5 - The Desired Underground Women"s Pro Lesbian Wrestling -

  • nanako miyamura star ameri censoredlesbianRCTDrocketkambe tarouRCTD-419RCTD4191rctd00419
    • 2021-08-28
    96 min

    300MAAN-690 [Geki Kawa Gal and Icharab Creampie SEX] Yuki-chan, a Yomimo and Galva clerk! A cute girl with a face-winning bruise, but a service-type small devil-type hidden bitch who wants to blame her nipples and give a blow job! I got drunk and bec

  • amateur censoredcreampieamateurmaanmaan-690maan690300maan-690



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download