javcensored high vision chubby big tits jav




FC2VENUCAWDSSISSHKDCHRVFSDSSMILKAVSAHNDHMNNGODVENXIPXSANADNHZGDDASDLULUAUKGHUNTB

2020-09-17
149 min

[PPPD-869]The Spence Gland Development Clinic Special Haru Kawamura

  • kawamura haru censoredbig titssquirtingPPPDoppaiPPPD-869PPPD869pppd00869
    • 2020-09-21
    126 min

    [GMEM-014]Confinement! Shame! Breaking In Training! Scream! Orgasms! An Orgasm And Scream-Filled Breaking In Training Session The Elite Narcotics Investigation Squad Tearful Waves Of Pleasure And Pain In Hell Her Finely Honed Body Goes Insane With Lu

  • ayano kato censoredsingle workGMEMavs collector sbaba za babbyavscollector s goldGMEM-014GMEM014gmem00014
    • 2020-09-26
    123 min

    [MIAA-321]I Accidentally Dropped My Sexiest Lingerie Onto The Balcony Below - Naughty Neighbor Gets The Wrong Idea And Ends Up Banging A Busty MILF All Night Long Mio Kimijima

  • kimishima mio censoredcreampiebig titsMIAAmoodyzham the mceveryone s porn starMIAA-321MIAA321miaa00321
    • 2020-10-02
    48 min

    FC2PPV 1520510 Weekend limited 1000pt off No26 The anime voice Lori was too erotic and dangerous.

  • amateur uncensoredfc2
    • 2020-10-04
    139 min

    [PKPD-113]Compensation Dating - 18-Year-Old Down With A Creampie - Barely Legal Beautiful Girl, Calm And Collected Sub Niko Tamaki

  • ring nico censoredcreampieschoolgirlPKPDfuck group and fun friends daydreamersPKPD-113PKPD113pkpd00113
    • 2020-10-04
    67 min

    326PIZ-023 Fluffy Toro F Cup J ○ and Ekiben Saddle Shooting! A suspicious ekiben craftsman who is a lively beautiful girl is a mischief! !! Plenty of raw vaginal cum shot from the sky with weightless intense piss ww

  • amateur censoredcreampiebig titspizpiz-023piz023326piz-023
    • 2020-10-06
    46 min

    FC2PPV 1524821 [Personal shooting] Tomohame! I took a gonzo like a friend ☆ Keiko 39 years old ☆

  • amateur uncensoredfc2
    • 2020-10-06
    63 min

    FC2PPV 1525132 [Individual] A 50-year-old mature teacher related to her students. Teacher disqualification Gonzo who becomes obedient and gets wet in the crotch without complaining to the students who are in a good condition [First special price]

  • amateur uncensoredfc2
    • 2020-10-15
    225 min

    [WA-440]12 Married Women Self Shots! Finger Inserted, Acme, Convulsions: Masturbation

  • censoredWAlotusWA-440WA440h-047wa00440
    • 2020-10-15
    58 min

    [orec-612]りん

  • amateur censoredcreampieamateurorecorec-612orec612orec-612
    • 2020-11-13
    241 min

    [SABA-657]Every Babe Has G-Cup Titties Or Bigger! A Female Readers Choice High-Class Oil Massage Parlor Gets The Hidden Camera Treatment! When This Big Tits Beauty Receives An Excessive Sexual Massage, She'll Keep On Cumming Until She Loses Her M

  • censoredbig titsamateurSABAskyu shirotoSABA-657SABA657h-244saba00657
    • 2020-11-19
    120 min

    [BLK-472]Voluptuous Office Girl Cums Hard - She Punches Out At 5 For Some Creampie Overtime

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-472BLK472blk00472
    • 2020-12-10
    120 min

    [HBAD-565]The Clan That Fucks Together Stays Together This Big Stepbrother Was Secretly Fucking His Little Stepsister She Hates Her Stepdad, But When He Found Out, He Gave Her A Cock-Thrusting She Would Never Forget Rika Aimi

  • rumi tadami censoredbig titsblowjobHBADhibinonamitaro umababeHBAD-565HBAD5651hbad00565
    • 2020-12-18
    60 min

    Caribbeancom 121820-001 Double Penetration As Orgy Sena Kusunoki

  • sena kusunoki uncensoredanalcreampiecaribbeancom
    • 2020-12-21
    116 min

    [APNS-218]Beautiful Lawyer Corrupted Mio Hinata

  • hinata clan censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-218APNS218apns00218
    • 2020-12-21
    151 min

    [APKH-158]Beautiful Girl In Uniform Is A Secretly A Freaky Slut! Filthy POV Footage - Cum From A Spectacular Blowjob! She Cums Hard On Cock, And Will Stick Her Tongue In Your Anal Hole! Narumi Hirose

  • narumi hirose censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-158APKH158apkh00158
    • 2020-12-26
    182 min

    [MIFD-143]I Found A Sexy Part-Time Job. A Fresh Face, Innocent, Natural Airhead Young Lady Her Adult Video Debut Asuna Sato

  • asuna sato censoredbeautiful girlsingle workMIFDmoodyzmametaro mamezawamoodyz freshMIFD-143MIFD143mifd00143
    • 2020-12-30
    75 min

    10musume 123120_01 First time shave of my pussy : embarrassing completely visible

  • amateur uncensored10musume
    • 2021-01-02
    91 min

    345SIMM-588 The true nature of the honor student J ○ is a perolist who licks the unwashed armpits, toes, and buttocks! Also, a perverted M girl who is happy with Oshioki! !! Hugging my uncle’s chin with a co ○ who is too sensitive in seconds ♪ I

  • amateur censoredcreampieuniformsimmsimm-588simm588345simm-588
    • 2021-01-08
    32 min

    [BTH-103]If You Cum On My Face My Husband Will Notice... So Please, Cum In My Mouth Ayumi Takanashi

  • ayumi takanashi censoredmarried womanbukkakeBTHchobitchchovicBTH-103BTH103h-1435bth00103
    • 2021-01-16
    477 min

    [OFJE-294]Dripping Body Fluids Until Your Sweat Glands Run Dry! Whole Bodies Glistening, Slick, And Supple For Sex 50 Fucks, 8 Hours

  • otoshiro sayaka jun jun censoredsquirtingOFJEs1 no 1 styleOFJE-294OFJE294ofje00294
    • 2021-01-29
    61 min

    FC2PPV 1662148 Only now 980pt [First shot first cum shot] Gravure Shinozaki ● Love super similar !! 20 years old Geki Kawa baby face busty female college student and raw squirrel cum shot SEX, further reinsert and scrape sperm

  • amateur uncensoredfc2
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-25
    176 min

    [NHDTB-498]This Temp Worker Was Wearing An Outfit That Was Definitely Not Appropriate For The Office, Because It Fit Her Big Tits And Body Like A Glove And She Was Unwittingly Luring All The Men To Temptation, And She Was Begging To Be Fondled And Ca

  • censoredbig titssquirtingNHDTBnatural highhopeless dainanaNHDTB-498NHDTB4981nhdtb00498
    • 2021-03-11
    131 min

    [IENF-129]Picking Up Party Girls With The Offer Of A Free Massage! Bratty Sluts Seduced With An Erotic Massage Get So Horny They Cum Like Crazy And Quickly Transform Into Raging Nymphos Made To Take Creampies

  • natsuho imai misuzu kawana censoredcreampieIENFi energyienfIENF-129IENF1291ienf00129
    • 2021-03-11
    35 min

    [GRMR-037]嫉妬彼氏の束縛エッチ ～優しい彼のドSなお仕置き～

  • ako momona kou akemi mari koizumi hiroomi nagase censoredGRMRmura chleo hakusanGRMR-037GRMR037h-1534grmr00037
    • 2021-03-12
    66 min

    328HMDN-344 [Abdominal muscle slender] Gonzo outflow of active medical college student Immediately withdrawal from school Affair sex with a married man who burns passionately

  • amateur censoredamateurbeautiful girlhmdnhmdn-344hmdn344328hmdn-344
    • 2021-03-19
    114 min

    [MGMQ-068]Our Slutty Teacher Loves To Break In Submissive Guys' Anal Holes With Her Strap-On! Momo Hazuki

  • hazuki peach censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-068MGMQ068mgmq00068
    • 2021-04-14
    120 min

    [GVH-218]Naughty Nurses Ka Ayano Fuji

  • ayano kato censoredcreampiegrandfatherGVHglory questhyonGVH-218GVH21813gvh00218
    • 2021-04-24
    73 min

    FC2PPV 1784119 Rem-chan with beautiful legs-Ecchi edition-I’ll call the Demon King (stick) even if it’s not in a different world ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-04-29

    FC2PPV 1794238 ☆ First shot ☆ Complete appearance ☆ Beautiful beauty witch 52 years old! Glamorous body with plenty of sex appeal ♥ Squirting turbulent squirting Creampie SEX ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-05-01
    161 min

    [DKWT-009]My Lust Won't Stop... An Unsatisfied Unfaithful Slut Housewife With A Big Ass - Airi 28 Years Old, Married 8 Years

  • censoredsquirtingblowjobDKWToffice k syoung wife.communicationDKWT-009DKWT00936dkwt00009
    • 2021-05-20
    78 min

    484SDGN-013 Let’s spread to the world! Nakadashi no Wa! I urged an AV actress and made a vaginal cum shot! ~ Chiharu Miyazawa ~

  • amateur censoredcreampiesquirtingsdgnsdgn-013sdgn013484sdgn-013
    • 2021-05-28
    121 min

    [WAAA-065]Shooting Cum Inside Of Her After She's Already Orgasmed! Moa Maeda

  • maeda momoko censoredcreampiebig titsWAAAwanz factorywanzWAAA-065WAAA065waaa00065
    • 2021-06-10
    107 min

    [FGAN-042]My Very Own Panty Shot Doll Hinako

  • censoredcosplayFGANfetish eyesFGAN-042FGAN042h-1440fgan00042
    • 2021-07-14
    120 min

    [SPRD-1442]Coming Inside Stepmother For The First Time, Starring Mizukami Yukie

  • mizukami yukie censoredmarried womansoloworkSPRDtakara eizokyuta tukumoaleddinSPRD-1442SPRD1442
    • 2021-08-12
    65 min

    SIRO-4596 [First Shot] [Innocent Beauty] [Hidden M Attribute] High Spec JD Advent With Looks And Masochist Constitution That Is As Good As An Idol. A Lustrous Woman Who Turns From Her Eyes Swimming Due To Her Tension, Her Pleasure Is Unlocked And Inc

  • amateur censoredamateursirosiro-4596siro4596siro-4596
    • 2021-09-02
    71 min

    [REBD-584]Remu4 Last Paradise. Remu Suzumori

  • suzumori remu censoredbig titssingle workREBDrebeccazack araiREBD-584REBD584h-346rebd00584
    • 2021-09-04
    70 min

    H4610 tk0042 Erina Terama 20years old

  • amateur uncensoredh4610
    • 2021-09-11
    141 min

    [APAK-199]A Lusty Ass Maso Fresh Face Female Employee Furious And Sweaty Adultery Sex At A Love Hotel With Her Horny Boss! "I Want You To Fuck Me Like A Dog ..." Kana Sasaki

  • natsuna sasaki censoredcreampiesingle workAPAKaurora project annexrkAPAK-199APAK199apak00199
    • 2021-09-11
    52 min

    H0930 ki210912 Ikue Katahira 47years old

  • amateur uncensoredh0930
    • 2021-09-18
    148 min

    [MMKS-016]Mean Service: A Healing Big Butt Soapland Princess June Lovejoy

  • june lovejoy censoredsingle workMMKSmarrionmiyamoto kojirouirisMMKS-016MMKS016mmks00016
    • 2021-10-01
    220 min

    [WAAA-100]Tsubomi"s First Ever Kabukicho Experience: A Sex Industry Nightlife Report With Tons Of Fucking And Cumming

  • bud censoredcreampieblowjobWAAAwanz factoryWAAA-100WAAA100waaa00100
    • 2021-10-06
    66 min

    534IND-001 G Breasts ○ Cum Inside Sister’s Creampie Half-Cut Video Leaked! !! The Case Of Being Unintentionally Squeezed By A Foxman With Big Tits Swaying With Intense Mapis (Yuri Asada, Monami Yuyu)

  • amateur censoredcreampiebig titsindind-001ind001534ind-001
    • 2021-10-15
    123 min

    [FOCS-029]Picking Up Girls To Meet An SSR Tier Ultra Cute Gal That Wants To Be A Total Fuck Buddy! Face Off To See Who Gets To Fuck! Record Of This Slutty Girl"s Amazingly Hot Sex! Yuna Himekawa

  • yuuna himekawa ran tsukishiro censoredslutsingle workFOCSabc mousou zokufocusFOCS-029FOCS029focs00029
    • 2021-10-21
    93 min

    [OKS-122]Erina Oka: Wet And Shiny, A Perfect Fit For A Godly Swimsuit! Enjoy These Cute Girls In Swimsuits! This AV Starts With A Voyeur Scene Of Big And Small Breasted Girls Changing Clothes And Turns To Close-up Fetishes Including Shaved Pussy, Sid

  • hill erina censoredschoolgirlbeautiful girlOKSoyaji no kosatsukami sukumizuOKS-122OKS1221oks00122
    • 2021-10-29
    118 min

    [MIAA-522]"What？ Did You Have Such A Big Dick？" Backstage Refreshment Bar At School Festival! Extreme Service For Which A Line is Formed! Uniform Pink Salon. Wan Horikita

  • horikita wan censoreduniformblowjobMIAAmoodyzkyaputen ebaraminna no kikatanMIAA-522MIAA522miaa00522
    • 2021-11-19
    95 min

    277DCV-194 Is It Okay To Send It Home？ Case.188 Beautiful "Supreme Standing Back" [8 Heads, G Cup, Waist 56 Cm, Ultimate Beauty Body, Sp] ⇒ Tears On Your Nasty Face … No Problem In The Neighborhood! Full Throttle 100 Iki Crazy ⇒ I Want T

  • amateur censoredbig titsamateurdcvdcv-194dcv194277dcv-194



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download