javcensored high visio big tit couple jav




FC2BBANAUKSLULUROYDNATRMIDVHDKAAVSASSISSQTEGVHCJODAWDCAWDSHKDSPRDDASDNACRFSDSSMVSD

2020-10-20
54 min

285ENDX-310 Yurina-san, 21 years old, a female college student who is cool with just a nipple [Amateur]

  • amateur censoredbig titsamateurendxendx-310endx310285endx-310
    • 2020-10-23
    230 min

    [PARATHD-3020]Extremely Kinky Mature Ladies! 20 Sexy Ladies Who'll Make You Jizz Your Pants! 4 Hour Special (4)

  • censoredcreampieamateurPARATHDparadise tvPARATHD-3020PARATHD3020parathd03020
    • 2020-10-30
    48 min

    [MASE-004][Delivery Only] Married Woman's Adultery An Mashiro

  • anne mashiro censoredcreampiebig titsMASEcrystal picturemadam maniac plusMASE-004MASE00449mase00004
    • 2020-10-31
    171 min

    [WAAA-010]Erotic Massage Master Turns A College Girl's Whole Body Into An Ultra Sensitive Erogenous Zone And Makes Her Cum Until She Swoons... Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiesingle workWAAAwanz factorywanzWAAA-010WAAA010waaa00010
    • 2020-11-20
    115 min

    [PARATHD-3040]The Colossal Tits Club (2) Complete Version - Proud Hotties With Enormous Knockers Go Bouncing Their Boobs

  • natsuko mishima rina ayana akari nanara censoredbig titsPARATHDparadise tvPARATHD-3040PARATHD3040parathd03040
    • 2020-11-27
    300 min

    [WZEN-040]Other Men's Wives Are So Hot! Married MILFs Looking To Earn Some Secret Cash On The Side By Doing Porn!

  • censoredamateurblowjobWZENwaap entertainmentWZEN-040WZEN0402wzen00040
    • 2020-11-27
    121 min

    [BANK-020][New Release 10/20] Brown-Skinned Stylish Girl With Big Beautiful G-Cup Tits! This Gal Is Super Cute And Has A Really Perverted Tongue

  • censoredcreampiebig titsBANKpussy banktake chanBANK-020BANK020h-1495bank00020
    • 2020-11-28
    240 min

    [MCSR-417]Cuckolded Defenseless Married Women - 9 People, 4 Hours

  • censoredmature womanMCSRbig morkalbooker tmascottMCSR-417MCSR41757mcsr00417
    • 2020-12-01
    99 min

    [SHMO-176]Venus Terme/Ryoko Maki

  • maki ryouko censoredsoloworkSHMOorustak softSHMO-176SHMO176
    • 2020-12-14
    57 min

    FC2PPV 1587215 The rumored super cute 18-year-old second work on the way back from the cram school, a dense secret meeting at the hotel, a large possibility that the van will end immediately, with the first limited privilege

  • amateur uncensoredfc2
    • 2021-01-07
    30 min

    C0930 ki210107 Ayano Matsuzaki 23years old

  • amateur uncensoredc0930
    • 2021-01-10
    118 min

    390JNT-014 [A sexually explicit spear man who makes a man 1000 squid] I ● SNS picking up a bartender of whip whip BODY who puts an erotic selfie on the star! !! Don’t miss the non-hampered Feratech of Yariman GAL who boasted that “There is

  • amateur censoredcreampiesquirtingjntjnt-014jnt014390jnt-014
    • 2021-01-13
    30 min

    FC2PPV 1643439 [Completely Clothed / Creampie] Sexy lingerie and super glossy pantyhose in a tight shirt that emphasizes the erotic body makes it vulgar! Classmate mature woman who is pleased with sperm bukkake on her pussy

  • amateur uncensoredfc2
    • 2021-01-16
    63 min

    418YSS-080 Ameri

  • amateur censoredamateurslutyssyss-080yss080yss-080
    • 2021-01-23
    118 min

    [CAWD-166]Arguments, The Doldrums, Boredom... When Things Started To Go Wrong With Our Marriage, I Began To Become Attracted To My Little Sister-In-Law While My Wife Was Committing Infidelity, And Then We Fell In Love And Committed Forbidden Adultery

  • yume kotoishi censoreduniformschoolgirlCAWDkawaiitake dCAWD-166CAWD166cawd00166
    • 2021-02-09
    60 min

    HEYZO 2455 Comforting With Marshmallow-Like Tits – Ayane Sakurai

  • ayane sakurai uncensoredcreampieblowjobheyzo
    • 2021-02-19
    93 min

    [MYBA-031]Married Slut Ayaka Muto

  • ayaka muto censoredmature womansingle workMYBAhitozuma engokai emmanuelleihyo kairoiMYBA-031MYBA031myba00031
    • 2021-02-19
    480 min

    [MBM-269]mpo.jp Presents Nonfiction: The Best Real Amateur Pick Ups (Fun Intimate Fucks Edition) 38 Girls, 8 Hours, Best Collection

  • censoredamateurMBMprestigempo selection.committeembmMBM-269MBM269118mbm00269
    • 2021-02-20
    120 min

    [NXG-360]Would You Like To Work A Part-Time Job？ We Propositioned This Elder Sister Type "We Absolutely Won't Ever Lay A Finger On You!! And We'll Pay You If You'll Hear Out Our Erotic Requests Please!!"

  • censoredamateurblowjobNXGstar paradisenext groupNXG-360NXG360h-254nxg00360
    • 2021-02-20
    59 min

    Pacopacomama 022021_437 Wives Drink Cum 117 Chisato Nishiyama

  • amateur uncensoredpacopacomama
    • 2021-02-25
    123 min

    [RCTD-384]

  • shiiki walnut kohinata mai censoredlesbianmature womanRCTDrockettaro kanbeRCTD-384RCTD3841rctd00384
    • 2021-03-12
    244 min

    [MGT-137]Street Corner Amateur Pick Up Artists! Vol 102 Introduce Me To One Of Your Slutty Friends! 16

  • censoredcreampieamateurMGTprestigemegatraMGT-137MGT137118mgt00137
    • 2021-03-29
    43 min

    362SCOH-038 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [De ● Zi] Miori Ayaba

  • amateur censoredcreampiebig titsscohscoh-038scoh038362scoh-038
    • 2021-04-02
    158 min

    [HUNBL-040]Long-Distance Shame She Got A Remote-Controlled Vibrator Plunged Into Her Pussy, And Now She's Trying Desperately Not To Cum While Working, As Her Cunt Begins To Drip And Dribble

  • censoredcreampieHUNBLhuntergeminihhh groupHUNBL-040HUNBL040hunbl00040
    • 2021-04-02
    121 min

    [NDRA-086]The Wife Who Became The Neighbor's Lover 33 Mio Kimijima

  • kimishima mio censoredbig titsmature womanNDRAjet eizomanji groupNDRA-086NDRA086ndra00086
    • 2021-04-09
    160 min

    [MDBK-171]Creampie With Excuses - High S*********l 4

  • ichika matsumoto tsukino sakura censoredcreampieschoolgirlMDBKbazookamaso knifeMDBK-171MDBK171mdbk00171
    • 2021-04-26
    78 min

    FC2PPV 1765188 Former subordinate Nao (Nao) ❤️ Squid with 3 points of blame of chestnut electric massage machine, thick vibe and anal vibe ❤️ Please pay attention to the volume. There is a purchase privilege

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-30
    71 min

    259LUXU-1422 Luxury TV 1398 A Beautiful Big Tits Nurse Appears In An AV In Search Of Passionate Sex! Obscenely bewitchingly disturbed with all one’s heart … Squirting cum with so much pleasure!

  • amateur censoredbig titsamateurluxuluxu-1422luxu1422259luxu-1422
    • 2021-05-12
    75 min

    326KJO-002 [Exotic F Big Breasts] 18 Years Old Half GAL [Creampie 3 Barrage! ] Hope of the Yariman world expectation that has already exceeded 10 experienced people appears! GET on Takeshita Street ⇒ Horseback riding machine experience ⇒ Air cowgirl

  • amateur censoredcreampiebig titskjokjo-002kjo002326kjo-002
    • 2021-05-15
    120 min

    [SYKH-026]G-cup Married Nurse Who Lives In Kansai Cumming Inside Of Her Orgasming Pussy Without Permission Shion-san 25 Years Old

  • censoredcreampieamateurSYKHleisurely missus emmanuelleSYKH-026SYKH026sykh00026
    • 2021-05-16
    35 min

    248DDG-730 Take a picture of me Yui

  • amateur censoredsquirtingamateurddgddg-730ddg730248ddg-730
    • 2021-05-20
    122 min

    [NHDTB-534](Cum D***king Love And Entertainment) This College Girl Was Put Under A Spell, In Which She Would Love D***king Cum The More Cum She Drank, Until She Was Dominated In Body And Soul Into A Creampie-Hungry Bitch Who Wanted To Descend Into Th

  • censoredcreampieamateurNHDTBnatural highhopeless dainanaNHDTB-534NHDTB5341nhdtb00534
    • 2021-05-22
    150 min

    [GMEM-033]Tall Masochistic Athletic Girl Is A Perverted Anal Slut Haruka

  • haruka censoredanalsingle workGMEMavs collector sparky kanekoavscollector s goldGMEM-033GMEM033gmem00033
    • 2021-06-12
    60 min

    383REIW-073 Maya

  • amateur censoredcreampieamateurreiwreiw-073reiw073383reiw-073
    • 2021-06-18
    56 min

    FC2PPV 1875825 ★ First shot amateur ☆ I like raw ♥ Bisho wet sensitive erotic girl ♥ Tamae-chan 19 years old ☆ Pleasure squirting Iki ♥ Agony! Rich Blow ♥ Cum Inside With Raw Saddle ♥ [Individual Shooting] * With Benefits

  • amateur uncensoredfc2
    • 2021-06-24
    120 min

    [DLDSS-014]A Married Woman With Big Tits Fucks Her Father-In-Law While Her Husband Is In Hospital - She Falls For His Kisses And His Aphrodisiacs - Riho Agatsuma

  • riho gazuma censoredbig titssingle workDLDSSdahliaebiDLDSS-014DLDSS0141dldss00014
    • 2021-06-25
    121 min

    [MIAA-461]Even Though I'm A Teacher I Couldn't Resist My S*****t's Seduction And I Fucked Her Raw Over And Over At A Love Hotel After School... Ena Koume Hana Himesaki

  • ena koume himesaki hana censoredcreampiebig titsMIAAmoodyzsapporo taroeveryone s porn starMIAA-461MIAA461miaa00461
    • 2021-07-01
    59 min

    H4610 ki210701 Sachie Murayama 34years old

  • amateur uncensoredh4610
    • 2021-07-15
    47 min

    481SACZ-045 Chika 3

  • amateur censoredamateurbdsmsaczsacz-045sacz045481sacz-045
    • 2021-08-13
    150 min

    [BLK-514]You"ll Enjoy Our Nipple-Licking Handjob Services ... They"ll Seriously Blow Your Mind! This Slender Gal With Long Legs Always Wanted To Be A Slut, And Now She"s Making Her Adult Video Debut Miyu Ouka

  • miyu sakuraka censoredsquirtingslutBLKkira kirazampakira hosi kira black galBLK-514BLK514blk00514
    • 2021-08-21
    241 min

    [MDBK-194]Ultimate Creampie, Thick SEX: 50 People, 4 Hours

  • natsuho imai yano tsubasa censoredcreampiebig titsMDBKk m producek taroubazookaMDBK-194MDBK194mdbk00194
    • 2021-09-01
    69 min

    FC2PPV 2118325 [Limited To This Summer] Virgin Real Middle-Aged Tag. You Can Do Anything If You Catch It ~ Summer Memories ~ * Drone Shooting

  • amateur uncensoredfc2
    • 2021-09-03
    123 min

    [WAAA-095]My Colleague Seduced Me With Her Ass And Made Me Fuck Her Over And Over Yu Shinoda Aoi Kururugi

  • shinoda yu aoi kururugi censoredcreampieslutWAAAwanz factoryWAAA-095WAAA095waaa00095
    • 2021-09-17
    75 min

    299EWDX-379 Slender G Cup Wife Is Ok Creampie! Raw Saddle Sex Brought Home!

  • amateur censoredcreampiebig titsewdxewdx-379ewdx379299ewdx-379
    • 2021-09-26
    74 min

    FC2PPV 2251822 * Limited Time 1980pt [Until 10/2] The Strongest Beauty Big Tits ★ Full Erection Desperate! Loli Face Big Pie Daughter And Saddle Rolled Stay Home

  • amateur uncensoredfc2
    • 2021-10-02
    139 min

    [MMUS-057]Small, Devilish And Provocative Beautiful Girl - Ena Satsuki

  • ena satsuki censoredbeautiful girlslutMMUSmarrionkasai kijinkcpMMUS-057MMUS057mmus00057
    • 2021-10-06
    49 min

    541AKYB-010 Hitomi (28) Nasty, De M G Cup Sister ♪

  • amateur censoredanalbig titsakybakyb-010akyb010541akyb-010



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download