javcensored censored mature woman hours more best omnibus




FC2MARANGODWAAASSISHNDSHKDBBANCHRVFSDSSDTTVENXATIDMIAAGMEMMEYDMILKCAWDCESDNNPJVEMA

2021-01-10
180 min

Pacopacomama 011021_418 Rieko Kohashi, Hitomi Nagase,Kumiko Kikuchi, Suzu Motomiya, Chika Yoda

  • rieko kohashi suzu motomiya uncensoredcreampiebig titspacopacomama
    • 2021-01-28
    125 min

    [JRZE-025]First Time Filming My Affair: Minami Masaki

  • minami masaki censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-025JRZE025h-086jrze00025
    • 2021-01-29
    50 min

    495MOJ-003 Sena

  • amateur censoredcreampieuniformmojmoj-003moj003495moj-003
    • 2021-01-30
    34 min

    FC2PPV 1664992 [Junior-kun ②] When I applied a junior from a sexual desire monster company and a baby-faced beautiful girl … It was more like copulation than naughty (laughs)

  • amateur uncensoredfc2
    • 2021-02-14
    73 min

    200GANA-2436 Seriously Nampa, first shot. 1598 Bring a female college student who came to Tokyo from Fukuoka but has no accommodation to the hotel! Good reaction barrage with SEX that was weak to push and accepted! Moe into a dialect that pops out oc

  • amateur censoredbig titssquirtingganagana-2436gana2436200gana-2436
    • 2021-02-26
    141 min

    [SQTE-360]Creampie Sex With Nene And Her Godly Breasts - Nene Tanaka

  • nene tanaka censoredcreampiebig titsSQTEs cuteSQTE-360SQTE360sqte00360
    • 2021-02-26
    56 min

    FC2PPV 1702932 [170cm x super beautiful legs] [4K shooting] Super obscene pantyhose is super obscene. “I love sex www” Fully dressed sexual intercourse that still devils

  • amateur uncensoredfc2
    • 2021-03-04
    86 min

    [HIMA-092]I Love My Stepmom And Now She's Getting Remarried Miyuki Aoyama

  • miyuki aoyama censoredcreampiemarried womanHIMAcenter villageshibuyahanazono center villageHIMA-092HIMA092h-086hima00092
    • 2021-03-06
    117 min

    [ATID-453]Enema Monster: Bringing A Top Idol Into Anal Agony - Chiharu Miyazawa

  • chiharu miyazawa censoredsingle workATIDattackerseitaro hagaein madATID-453ATID453atid00453
    • 2021-03-11
    54 min

    FC2PPV 1722153 ≪Re-appearance≫ Nasty and lewd receptionist (19) Clothes play ❤ I’m hungry for being controlled by a man and grinning w Man hair bobo I was thrust into a sensitive pussy and rolled up continuously → I got a lot of vaginal cum shot

  • amateur uncensoredfc2
    • 2021-03-13
    118 min

    [MIAA-402]I Got Hooked Up With A Runaway Free Pussy College Girl Who's Young Enough To Be My Daughter!! This Old Man Was Holed Up In His Home And Having Raw Fucking Creampies From Morning Until Night In A Lockdown Fuck Fest Nene Tanaka

  • nene tanaka censoredcreampiebig titsMIAAmoodyztequilia tinoeveryone s porn starMIAA-402MIAA402miaa00402
    • 2021-03-18
    231 min

    [HUNTA-973]Hot Hard-Working Girls (Nurses, Teachers, Office Workers...) So Lost In Their Jobs That They Don't Notice They're Flashing Guys With A Panty Shot - And Getting Them Rock Hard! 2

  • censoredblowjobHUNTAhuntermorikihhh groupHUNTA-973HUNTA973hunta00973
    • 2021-03-27
    130 min

    [RMER-001]Popsicle Man - Ai Hitomi

  • hitomi love censoredsingle workRMERrare daydream tribetamao arakiRMER-001RMER001rmer00001
    • 2021-04-03
    120 min

    [NASH-485]Passionate Trip With My Stepmom: Family Fun In The Steamy Hot Springs - 6 Stories

  • censoredmilfmature womanNASHpinknadeshikoNASH-485NASH485nash00485
    • 2021-05-04
    67 min

    SIRO-4408 [First shot] [Fair-skinned active nurse] [Pushing into the back of the vagina ..] An inexperienced nurse teaches an adult. If you pierce with a big cock like playing with a delicate body .. AV application on the net → AV experience shooting

  • amateur censoredamateursirosiro-4408siro4408siro-4408
    • 2021-05-15
    123 min

    [ZEX-404]THE PERFECT ORGASM MANUAL How To Make Any Man Or Woman Achieve The Greatest Squirting Orgasm - A Sexual Problem-Solving Special To Help You Realize Truly Pleasurable Sexual Ecstasy - Mikako Abe

  • abe mikako censoredbeautiful girlsingle workZEXpeters maxZEX-404ZEX404h-720zex00404
    • 2021-05-20
    121 min

    [FSDSS-231]For The Ultimate Masturbation Complete POV I Will Provide The Best Ever Masturbation Support Yui Shirasaka

  • yui shirasaka censoredblowjobcosplayFSDSSfalenokei isoifaleno starFSDSS-231FSDSS2311fsdss00231
    • 2021-05-21
    28 min

    FC2PPV 1829598 [No] [Limited to 100 pieces 2980 → OFF to 1480pt!] God body rookie gravure ♥ ️ tall beautiful legs beautiful breasts perfect ♥ ️ mass cum shot! !! ♥ ️ * Review benefits / High quality Ver

  • amateur uncensoredfc2
    • 2021-05-22
    125 min

    [BHSP-025]Impregnating The Masochistic Jogger Who's Addicted To Deep Throating Yurino Matsuhara

  • yurino matsubara censoredcreampiedeepthroatBHSPtoyohikozarakiseiunkaiBHSP-025BHSP025bhsp00025
    • 2021-05-26
    120 min

    [C-2640]My Wife's Friend Was Going To Spend The Night At Our Place "Her Name Is Misuzu-san (Not Her Real Name), She's A Married Woman, 30 Years Old" So Naturally, I Took Advantage Of The SItuation

  • censoredmarried womanamateurCgogoskoichi takahashicore gogo sC-2640C2640
    • 2021-06-01
    120 min

    [NACR-428]Daydreaming About My Son's Wife... Miyabi Midorikawa

  • midorikawa miyabi censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-428NACR428h-237nacr00428
    • 2021-06-11
    153 min

    [JUFE-296]Competitive Eater With An Insatiable Appetite For Food... And Cock! Pretty Grown Up Slut With A Sweet Smile - This Former Beach Volleyball Player Voraciously Devours Anything Put In Front Of Her In Her Porn Debut!

  • censoredbig titsJUFEfitchJUFE-296JUFE296jufe00296
    • 2021-06-12
    119 min

    [AUKG-514]Denim Maniacs H

  • nagatsuki natsuki shizuka sugisaki censoredlesbianAUKGu krentoAUKG-514AUKG514aukg00514
    • 2021-06-16
    120 min

    [GVH-250]Beautiful Teacher Stuck In Delinquent S*****t's Web - Rin Kira

  • kira rin censoredsingle workGVHglory questkimura hajimeGVH-250GVH25013gvh00250
    • 2021-06-16
    72 min

    469G-645 Imadoki Girls’ Yen Exchange (Daddy Activity) Circumstances! Miku

  • amateur censoredcreampiebig titsgg-645g645469g-645
    • 2021-06-19
    147 min

    [JUL-617]She Said It Was For Work: Adultery Trip Kana Yume

  • kana yui censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-617JUL617jul00617
    • 2021-06-20
    240 min

    [SCPX-427]Seduced By My Sister-In-Law - He Never Had A Chance to Resist Her! Easy Cheating Creampie!

  • censoredcreampieSCPXscoopSCPX-427SCPX427scpx00427
    • 2021-06-21
    63 min

    328HMDN-374 [Big Breasts! Aiuchi ○ Kaori Anna] Newlyweds caught with a handsome pie G cup 27-year-old mom cuckold and seed! Acme of delight being pierced by a raw dick.

  • amateur censoredcreampiebig titshmdnhmdn-374hmdn374328hmdn-374
    • 2021-07-08
    248 min

    [MIST-341]Mr. Michiru - Exclusive Actress Audition Grand Prix Winner: Ayaka Mochizuki x Mr. Michiru - 4 Hours

  • ayaka mochizuki censoredcreampiebig titsMISTmr michirusaitaMIST-341MIST3411mist00341
    • 2021-07-19
    76 min

    430MMH-016 [Glamorous Plump Body! ] Echichichi Beauty Who Comes Into Close Contact With Saffle From Noon Is The No. 1 Cabaret Girl Who Shakes Her Boasting Big Tits And Peach Butt Slowly And Slowly! Gonzo With 23-Year-Old G Cup Airi-Chan ♪

  • amateur censoredcreampiebig titsmmhmmh-016mmh016430mmh-016
    • 2021-08-14
    118 min

    [BBTU-019]Tit Masochist Miu Arioka

  • arioka miu censoredbig titssingle workBBTUdogmatenunore no boinBBTU-019BBTU019bbtu00019
    • 2021-09-10
    195 min

    [HUNTB-094]Naughty Sounds Of Knocking Boots At The Library! When A S********l Comes Across Erotica Her Panties Get So Drenched That She"s Down For A Quickie!

  • censoredcreampieschoolgirlHUNTBhunterkawajirihhh groupHUNTB-094HUNTB094huntb00094
    • 2021-10-07
    124 min

    [FSDSS-311]I"ll Do It For The Money. My Friend"s Girlfriend Finds More Than A Job By Selling Herself For Sex. Kaname Momojiri

  • kaname momojiri censoredbig titsblowjobFSDSSfalenoisoi keifaleno starFSDSS-311FSDSS3111fsdss00311
    • 2021-10-09
    118 min

    [APNS-259]Young Wife Has To Work To Make Up For Her Husband"s Business Failure..., Starring Alice Nanase

  • alice nanase censoredcreampiesingle workAPNSaurora project annexnasu yukihiroAPNS-259APNS259apns00259
    • 2021-10-20
    30 min

    279UTSU-519 Mako-San

  • amateur censoredbig titsmarried womanutsuutsu-519utsu519279utsu-519
    • 2021-10-23
    63 min

    H4610 ki211024 Mayumi Shimoyama 24years old

  • amateur uncensoredh4610
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-30
    181 min

    [EMBZ-237][NSFW] MILF Orgy Fuck Movie File #10 "Victim: Glamorous Housewife"

  • saki firewood miya katase miso censoredcreampiebig titsEMBZjuku onna juku emmanuellejuku onna jukuEMBZ-237EMBZ237embz00237
    • 2021-10-30
    120 min

    [GVH-315]Stepmom"s Real Sex Ed, Aika Natsume

  • aika natsume censoredcreampiemomGVHglory questkisakura kabinGVH-315GVH315gvh00315
    • 2021-10-30
    77 min

    300NTK-653 [Uncle Chin Geki Iki Beautiful Bomb Butt JD] [Job Hunting 3P Skillful Jiji Tech Geki Iki] Job Hunting JD Duo Who Will Give 3P To The End Of The Dirty Little Erotic Old Man! !! Erotic Curiosity Of Lewdness Confirmed From Jijii Squared Parad

  • amateur censoredcreampieamateurntkntk-653ntk653300ntk-653
    • 2021-11-11
    130 min

    [STARS-479]久しぶりの帰省…大嫌いだった近所の粘着オヤジに汗だくでイカされ続けたお盆休み 戸田真琴

  • amateur censoredSTARSsodSTARS-479STARS479
    • 2021-11-13
    46 min

    H4610 ori1768 Natsuki iguchi 20years old

  • amateur uncensoredh4610
    • 2021-11-20
    137 min

    [CEMD-086]My Body And Mind Disintegrated And Became At My Beck And Call Rina Takase - Look At Me As A Lecherous Courtesan Pet.

  • rina takase censoredbig titsmature womanCEMDceleb no tomoCEMD-086CEMD086cemd00086
    • 2021-11-22
    66 min

    OREX-324 Miku-chan (Miku Kurusu)

  • amateur censoredcreampieschoolgirlorexorex-324orex324orex-324
    • 2021-11-25
    111 min

    [SPRD-1485]Forgive Me... I Want This Son-in-law"s C***d Mio Saionji.

  • mio saizonoji censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1485SPRD148518sprd01485
    • 2021-12-16
    45 min

    10musume 121621_01 Amateur Girl who Has Beautiful Legs and Ass Gone Wild Kasumi Kawakami

  • amateur uncensored10musume
    • 2021-12-31
    146 min

    [NNPJ-493]Dripping, Overflowing Eros Company Erotica!! I Met A Sexy Elder Sister Type On Social Media, And To My Surprise ... She Was A SSS-Class High-Class Call Girl From A Famous Service. She"ll Hit You With Follow-Up Eros Company Sexiness To G

  • censoredcreampieamateurNNPJnanpa japanNNPJ-493NNPJ493nnpj00493
    • 2022-01-10
    300 min

    [016HEZ-368]センズリ鑑賞100人 5時間

  • amateur censoredbig titsmarried womanhezhez-368hez368016hez-368



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download