javcensored censored def jav beautiful girl




FC2STARSDASDVEMAMVSDSHKDWAAAAVSAMIDVAPODHDKASANLULUEBODSSISMILKMARAMIDENGODCJODNACR

2018-06-23
119 min

[MIAE-261]A Panting And Moaning Blowjob While Cumming My Maid Will Be Sucking On My Cock While She Spasms In Ecstasy Mari Takasugi

  • mari takasugi censoredblowjobbeautiful girlMIAEmoody scomet akaimoodyz acidMIAE-261MIAE261miae00261
    • 2018-06-22
    150 min

    [MDTM-377]Beautiful Girl Basking In Countryside Sun: "Please Make Me Feel Good!" Hina Narumi

  • haruna narumi censoredcreampieschoolgirlMDTMmedia stationskillful between floorsspace planningMDTM-377MDTM37761mdtm00377
    • 2018-06-22
    479 min

    [BAZX-140]I Want To Fuck This Girl Complete Memorial Best Collection 24 Girls/480 Minutes

  • censoredamateurblowjobBAZXmedia stationbazookaBAZX-140BAZX14061bazx00140
    • 2018-06-22
    127 min

    [HCM-015]"A Divine Development!!" 10 We Just Happened To Cum Upon The Moment Your Eyes Get Captivated, And If Anything Were To Happen Afterward...

  • aragaki kotori sea sky flower censoredblowjobbeautiful girlHCMprestigedaydreamHCM-015HCM015118hcm00015
    • 2018-06-22
    479 min

    [MDTM-376]All New After School Beautiful Girl Rejuvenating Reflexology + Complete Greatest Hits Collection 480 Minutes

  • censoredcreampiebeautiful girlMDTMmedia stationspace planningMDTM-376MDTM37661mdtm00376
    • 2018-06-22
    215 min

    [SCPX-281]We Found This Slutty Slut Who Was Tempting Men By Wearing A Free Sex T-Shirt And Visibly Erect Nipples At An Offline Meetup And Had Creampie Sex With Her! 2

  • censoredcreampieamateurSCPXscooptodoSCPX-281SCPX281h-565scpx00281
    • 2018-06-22
    253 min

    [BAZX-141]Total Domain: Knee-high maniacs 2

  • censoredcreampieschoolgirlBAZXmedia stationone topbazookaBAZX-141BAZX14161bazx00141
    • 2018-06-21
    139 min

    [SDAB-060]"I Want To Get A Furious Fuck, Just Like They Do In Those AVs" Natsu Hashimoto An SOD Exclusive Debut

  • nao hashimoto censoredbeautiful girlSDABsod createnishinakajima southyouthSDAB-060SDAB0601sdab00060
    • 2018-06-21
    225 min

    [STAR-931]Once More An SODStar Momo Kato ka AV Debut

  • kato momoka censoredbeautiful girlSTARsod createeasy matsumotosod starSTAR-931STAR9311star00931
    • 2018-06-21
    130 min

    [STAR-928]Mana Sakura Non Stop Slippery Nipple Play! Super Cute Sex Worker Who Loves Nipple Play

  • mana sakura censoredcosplaybeautiful girlSTARsod createtiger gavelsod starSTAR-928STAR9281star00928
    • 2018-06-21
    173 min

    [FSET-772]I Sneaked Into A Forbidden Girl's Bed 11

  • amami heart rena otonashi censoredbig titsdramaFSETaquinoristickaknrFSET-772FSET7721fset00772
    • 2018-06-21
    94 min

    [OKS-042]Wet And Shiny And Tight A Goddess In A School Swimsuit Rio Okita We Bring You Cute Girls In School Swimsuits, From A Beautiful Girl To A Married Woman, All For Your Viewing Pleasure! Watch Them Change In Peeping Videos, And Check Out Their T

  • rio okita censoredbeautiful girlbukkakeOKSpersonal photography of fatherOKS-042OKS0421oks00042
    • 2018-06-21
    115 min

    [SDEN-030]SOD Arts Festival 2018 Panty Shots: OK! Sleeping Together: OK! Masturbation Support: OK! Of Course We Started A Refreshment Booth Where You Can Have Sex With All The Beautiful Girls As Much As You Want

  • ikuta miku ichinose momo censoredbeautiful girlSDENsod createcamelentrySDEN-030SDEN0301sden00030
    • 2018-06-18
    116 min

    [XVSR-386]Breaking The Limits 100 Mind-Shattering Forced Orgasms Moe Arihana

  • moe arika censoredbig titsbeautiful girlXVSRmax asono kancalenXVSR-386XVSR386xvsr00386
    • 2018-06-18
    140 min

    [XVSR-384]This Real Life Voice Actress Will Twitch And Throb And Spasm If You Tweak Her, And Then You Can Start Breaking In Her Pussy For Some Orgasmic Ecstasy!! Mai Mitsuki

  • mizuki mai censoredbeautiful girlXVSRmax ak c takedacalenXVSR-384XVSR384xvsr00384
    • 2018-06-18
    117 min

    [XVSR-393]Living Together and Having Sex With a Brother-Obsessed Sister Who Loves Creampies: Ayumi Kimito

  • kimi and ayumi censoredcreampiebeautiful girlXVSRmax asono kancalenXVSR-393XVSR393xvsr00393
    • 2018-06-18
    106 min

    [XVSR-388]Massive Climax X Max Convulsions Crazy Creampie Trembling Sex Ai Hoshina

  • sena ai censoredcreampieschoolgirlXVSRmax ashanti yazawacalenXVSR-388XVSR388xvsr00388
    • 2018-06-18
    119 min

    [XVSR-390]Forced Creampie Sex For an Innocent Schoolgirl Shiori Kuraki

  • kuraki bookmark censoredschoolgirlbeautiful girlXVSRmax asono kancalenXVSR-390XVSR390xvsr00390
    • 2018-06-17
    169 min

    [DASD-443]To All You Amateur Losers Who Don't Have Girlfriends We're Sending A Big Tits Girl To Your Home Natsu Rian

  • natsu natsu censoredcreampiebig titsDASDdassrokusaburo mishimaDASD-443DASD443dasd00443
    • 2018-06-17
    119 min

    [HND-527]This Teacher Appears To Be Prim And Proper, But The Truth Is She Wants To Tweak And Tease Her Students! A Real Life Cram School Teacher Makes Her AV Debut Sae Mashiro

  • yangpyeong river censoredcreampiebeautiful girlHNDbookhiroaHND-527HND527hnd00527
    • 2018-06-17
    118 min

    [HND-528]A Sensual Orgasmic Pussy Girl Who Cums So Much She's Addicted To Sex! A Natural Airhead Beautiful Girl Who Has So Much Lust She Made Her AV Debut!! Yuki Haruno (20 Years Old)

  • yuki haruno censoredcreampiebeautiful girlHNDbooktiger gavelHND-528HND528hnd00528
    • 2018-06-17
    118 min

    [HND-535]Meet And Instantly Fuck! A Quickie Cum Shot! While She's Still Twitching And Trembling After Creampie Sex, It's Time To Start Thrusting That Cock Again! "I Told You, I Already Came!" But We Ignored Her Protests And Kept On Cr

  • miyu amano censoredcreampiebig titsHNDbooktequilatinoHND-535HND535hnd00535
    • 2018-06-17
    119 min

    [HND-537]An Amateur Fan Thanksgiving Day Rika Mari In A High Speed Cowgirl Fuck If You Can Resist Her, She'll Agree To Creampie Raw Footage Sex

  • mari rika censoredcreampiebeautiful girlHNDbookzampaHND-537HND537hnd00537
    • 2018-06-17
    166 min

    [KAWD-908]A Major New Fresh Face! This Shy Girl Has An Angelic Smile Sora Asahi 20 Years Old A Kawaii* Exclusive Debut

  • morning su censoredbeautiful girlKAWDkawaiinishinakajima southKAWD-908KAWD908kawd00908
    • 2018-06-17
    119 min

    [DASD-439]A Beautiful Girl Little Sister Is Luring Me To Temptation With Her Big Ass, So I Banged Her From Behind With Babymaking Sex Aya Sazanami

  • aya sazanami censoredcreampiebeautiful girlDASDdasDASD-439DASD439
    • 2018-06-17
    120 min

    [HND-536]Pregnancy Guaranteed! Back Breaking Raw Cock Fucking Pregnancy Fetish Creampie Sex Azusa Ichinose

  • satoshi ichinose censoredcreampiebeautiful girlHNDbooksapporo taroHND-536HND536hnd00536
    • 2018-06-17
    149 min

    [KAWD-905]A Thin-Waisted Slender College Girl Twitching Premature Ejaculating Orgasms She Was Begging For Her First Ever Creampie Massive Spasmic Fuck Fumiko Araki

  • fumika araki censoredcreampieKAWDkawaiitake dKAWD-905KAWD905kawd00905
    • 2018-06-17
    184 min

    [HND-538]The Greatest Creampie Office Adultery Sex Ever, Awash In Love And Pleasure And Raw Fucking Akari Mitani

  • mitani akari censoredcreampiebeautiful girlHNDbooknanzaki masakiHND-538HND538hnd00538
    • 2018-06-15
    241 min

    [TIKB-028][Serious Nookie Action] Tons Of Fun In 4 Fully Satisfying Hours! We Slipped Some Aphrodisiacs To This Crazy Cute Girl And Giving Her A Pregnancy Fetish Fuck! And Now Her Brains Are Being Blown In A Serious Orgasmic High LOL Haruka Namiki

  • namiki haruka censoredcreampiebig titsTIKBchikikikikama delusion groupTIKB-028TIKB028tikb00028
    • 2018-06-15
    169 min

    [PTS-423]We're Here On Location Trying To Go Picking Up Girls, And There Was This One Girl Who We Couldn't Successfully Seduce Isn't She The Cutest!？ Look At Her Titties! See How Sexy She Looks! This Dental Assistant Has The 3 Greatest Qu

  • censoredcreampieamateurPTSpetersPTS-423PTS423h-021pts00423
    • 2018-06-15
    168 min

    [CHN-157]Renting New Beautiful Women ACT.82 Reina Kashima (AV Actress) 21 Years Old

  • reina kashima censoredsquirtingblowjobCHNprestigemanhattan kimuralendingCHN-157CHN157118chn00157
    • 2018-06-15
    201 min

    [FCH-014]A Beautiful Girl Gets Cum In Her Face! All Of Our Pent Up Cum Is Going To Get Splattered All Over Her Pretty Face! 200 Minutes Of Dripping, Thick Cum! 2nd

  • rika futaba shinoda yu censoredbeautiful girlFCHprestigefetish partyFCH-014FCH014118fch00014
    • 2018-06-15
    190 min

    [OYC-189]3 Hours To Go Until The First Train We Were At A Friend's Farewell Party And Brought Home These Girls So We Could Seduce And Film Them, Even Though They're About To Get Married. These Girls Are Engaged To Be Married, So Their Guards

  • censoredcreampieOYCdinner.companyspace nyanjirohhh groupOYC-189OYC189oyc00189
    • 2018-06-15
    117 min

    [TIKM-005][The Greatest & Best] This Beautiful Girl With Soft And Light Skin Will Slip That Rubber Off In Seconds And Let Me Fuck Her For Real Because She's My Very Own Shaved Pussy Pet

  • censoredcreampiebig titsTIKMchikikikikama delusion groupTIKM-005TIKM005tikm00005
    • 2018-06-14
    145 min

    [SSNI-240]Ayaka Wants To Live With You So She Can Get Lovey Dovey And Fuck Your Brains Out Ayaka Kawakita

  • ayaka hebei censoredbeautiful girlSSNIs one number one stylemonchans1 no 1 styleSSNI-240SSNI240ssni00240
    • 2018-06-14
    120 min

    [SSNI-233]Furious And Relentless Piston Pounding Second Helping Sex Against An Orgasmic Twitching And Throbbing Pussy Arina Hashimoto

  • there is hashimoto censoredsquirtingbeautiful girlSSNIs one number one stylemichiru arashiyamas1 no 1 styleSSNI-233SSNI233ssni00233
    • 2018-06-14
    118 min

    [IPX-158]Uncut! Non-Stop! A Large Orgies Battle Royale An Idol Vs 20 Big Dicks Kana Momonogi

  • kana momonogi censoredbeautiful girlbukkakeIPXidea pockettake dtissueIPX-158IPX158ipx00158
    • 2018-06-14
    241 min

    [TOMN-146]A Sure Thing Complete Aya Sazanami Greatest Hits Collection Unstoppable Consecutive Orgasmic Sex

  • censoredbeautiful girlTOMNteppanteppan specialTOMN-146TOMN146tomn00146
    • 2018-06-14
    226 min

    [GAPL-029]At This Hospital Designated By A Famous Young Ladies' School, All The Girls In Uniform Who Cum Here For Their Checkups Are Always Going To Be Stripped Down To Their Underwear! These Exhibitionist Bitches Are Showing Off Their Titties An

  • censoredcreampiebeautiful girlGAPLgreen applehhh groupGAPL-029GAPL029gapl00029
    • 2018-06-14
    479 min

    [OFJE-154]Miharu Usami S1 Debut 2 Year Anniversary Greatest Hits Collection All New 10 Titles, 54 Episodes, 480 Minute Special

  • miharu hanasaki censoredbig titsbeautiful girlOFJEs one number one styles1 no 1 styleOFJE-154OFJE154ofje00154
    • 2018-06-14
    119 min

    [IPX-159]This Young Wife Was Swept Away And Degraded By The Pleasures Of Sex With Her Father-In-Law... Minami Aizawa

  • minami aizawa censoredbeautiful girlIPXidea pocketzach araitissueIPX-159IPX159ipx00159
    • 2018-06-14
    170 min

    [SSNI-236]This Quickie Slave Maid Loves To Suck Cock So Much She'll Start Sucking Instantly, Anytime Yura Kano

  • yura kanno censoredbeautiful girlSSNIs one number one stylekyouseis1 no 1 styleSSNI-236SSNI236ssni00236
    • 2018-06-14
    119 min

    [MVSD-355]This Rich Old Man Can Do It! A Tennis Club JD Is Going Shopping For An Adult To Give Her Creampie Sex Rin Hatsumi Tsubasa Hachino

  • hatsumi ri yano tsubasa censoredcreampiecosplayMVSDm s video groupichiro kanedaMVSD-355MVSD355mvsd00355
    • 2018-06-14
    119 min

    [BLK-369]Would You Have A Drink With Me？ I'll Treat You To Korean BBQ! We Went Picking Up Girls And Found These Drunk College Girl Babes And Made Sure They Missed The Last Train Home! I Thought She Was A Conservative Shy Girl, But She Turned Out

  • censoredbeautiful girlBLKkira kirakira kira black galBLK-369BLK369blk00369
    • 2018-06-12
    128 min

    [KTRA-034]Yoshika Futaba's Sports Costumed Creampie Sex

  • rika futaba censoredbig titsbeautiful girlKTRAk tribeKTRA-034KTRA034h-094ktra00034
    • 2018-06-12
    117 min

    [KTRA-036]My Little Sis -- a Tiny Body with Giant Tits

  • ann wakamoto censoredbig titsbeautiful girlKTRAk tribeKTRA-036KTRA036h-094ktra00036
    • 2018-06-12
    132 min

    [FSRE-010]An AV Debut Nana Minami Translucent Fair Skin And A Beautifully Proportioned Body An Innocent And Pure 18 Year Old Nana Minami [Remastered Reprint Edition]

  • south nana censoredcreampiebeautiful girlFSREfirst starFSRE-010FSRE010h-491fsre00010
    • 2018-06-10
    134 min

    [SQTE-214]I Filmed A POV Video With My Beloved Girlfriend This Beautiful Girl With Light Skin Is Revealing All Of Her Honest Feelings In This Deep And Rich Love Affair

  • an sasakura yuuri censoredbeautiful girlSQTEs cuteSQTE-214SQTE214sqte00214



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download