javcensored censored best omnibus high vision




FC2SHKDAWDJUFEHNDAMBIHZGDSANSDABAUKGVEMACAWDSSISAVSAGVHMEYDMILKKBIHODVBBANABW

2020-11-23
62 min

345SIMM-558 Gonzo date at home after school with a student’s little J ●

  • amateur censoredcreampieuniformsimmsimm-558simm558345simm-558
    • 2020-11-28
    60 min

    383REIW-019 Haruka

  • amateur censoredamateurbeautiful girlreiwreiw-019reiw019383reiw-019
    • 2020-11-28
    29 min

    FC2PPV 1586596 [Leaked / Uncensored] Female-only aroma massage 20-year-old fair-skinned beautiful breasts hidden from raw erogenous zone development

  • amateur uncensoredfc2
    • 2020-11-29
    79 min

    [BAB-017]This Lingerie Shop Girl Wanted Some Raw Sex

  • censoredbig titsblowjobBABbabylon daydreamersBAB-017BAB017bab00017
    • 2020-11-30
    74 min

    328HMDN-316 Women’s University Volleyball Club Yuka-chan (21) A metamorphosis girl who seduces middle-aged people with erotic underwear with a garter ♪ Volleyball ass & huge breasts shake violently and cum many times! NTR daddy live copulati

  • amateur censoredbig titsamateurhmdnhmdn-316hmdn316328hmdn-316
    • 2020-12-05
    240 min

    [HUNTA-906]Taking A Young Unsatisfied Housewife I Met At My Part-Time Job Home To My Bachelor Pad To Fuck Her Crazy. We Haven't Even Kissed Yet. She Lied To Her Husband To Stay At My Place. Our First...

  • censoredcreampieHUNTAhunterkawajirihhh groupHUNTA-906HUNTA906hunta00906
    • 2020-12-06
    31 min

    FC2PPV 1596600 [Face exposure] Mother of two big breasts. In the room where you are sleeping with your child, you are conceived by being vaginal cum shot many times with two strange sticks in the back of the vagina

  • amateur uncensoredfc2
    • 2020-12-06
    100 min

    [AED-188]Family Fun: Giving A Creampie To A 50-something MILF - Akemi Narishima

  • akemi narishima censoredmature womansingle workAEDrubysusumu yanokuchieden rubyAED-188AED188aed00188
    • 2020-12-10
    133 min

    [NEO-748]Shameful Armpit Play - Rin Hatsumi

  • hatsumi rin censoredsquirtingsingle workNEOradixshio sakurabaneo paradoxNEO-748NEO748433neo00748
    • 2020-12-10
    105 min

    [ZEAA-056]Married Woman With Big Tits Takes Cum Bukkake - H-Cup's Creamy Delight Mako Oda

  • oda mako censoredbig titsmarried womanZEAAcenter villagesky cloudsthe pole center villageZEAA-056ZEAA056h-086zeaa00056
    • 2020-12-13
    122 min

    [VENU-986]Charming His Step-Mother To Let Him Creampie Her Bubble Butt Everyday Saya Minami

  • minami saya censoredcreampiemature womanVENUvenuskaniefakecest winntersVENU-986VENU986venu00986
    • 2020-12-20
    136 min

    [JUL-412]I Had To Leave My Lecherous Old Man And My Weak-Willed Wife For A 2-Night, 3-Day Business Trip. Sure Hope Nothing Happened... Natsu Tojo

  • natsu tojo censoredmature womansingle workJULmadonnamametaro mamezawaJUL-412JUL412jul00412
    • 2020-12-25
    240 min

    [MDTM-692]あなたの妄想実現します！夢のようなエロシチュエーション実行AV 4時間BEST

  • sena ai seirang igarashi censoreduniformschoolgirlMDTMk m produceuchuu kikakuMDTM-692MDTM692h-585mdtm00692
    • 2021-01-22
    51 min

    [oretd-830]RIKA

  • amateur censoredcreampiebig titsoretdoretd-830oretd830oretd-830
    • 2021-01-29
    54 min

    [per-364]ほの 2

  • amateur censoredbig titssquirtingperper-364per364per-364
    • 2021-02-04
    46 min

    FC2PPV 1672408 [First shot, super rare! ] Small animal young wife is cheating for the first time ♥♥ A state of absentmindedness to a cock larger than imagined.

  • amateur uncensoredfc2
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    136 min

    [CHN-197]New: We Lend Out Amateur Girls. 95 (Pseudonym) Suzune Akimoto (Grocery Store Clerk) Age 20

  • akimoto suzune censoredanalslutCHNprestigemanhattan kimurataiCHN-197CHN197118chn00197
    • 2021-02-19
    69 min

    [opcyn-154]るな(28)

  • amateur censoredsquirtingamateuropcynopcyn-154opcyn154opcyn-154
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-02
    84 min

    FC2PPV 1708904 ★ Appearance ☆ Alice, a neat quarter girl who changes suddenly with H, re-advents ☆ Sensitive erotic BODY leans back and convulsions intense Iki ♥ Plenty of vaginal cum shot in the pussy of a perverted beautiful girl who strips white e

  • amateur uncensoredfc2
    • 2021-03-06
    97 min

    [SHKD-936]A Pretty Girl In Pure White Gets Dirty - Sakura Tsukino

  • tsukino sakura censoredsingle workSHKDattackerssayaka datesharkSHKD-936SHKD936shkd00936
    • 2021-03-08
    78 min

    300MIUM-689 Tan gal wife! !! !! [Erection is inevitable in the sunburn marks that shine in the slender BODY] × [The body that has been fully developed seeks a penis and estrus MAX! ] × [Overwhelming pie pressure! Exquisite fucking pinch! !! ] Looks,

  • amateur censoredcreampiebig titsmiummium-689mium689300mium-689
    • 2021-03-13
    118 min

    [MIAA-402]I Got Hooked Up With A Runaway Free Pussy College Girl Who's Young Enough To Be My Daughter!! This Old Man Was Holed Up In His Home And Having Raw Fucking Creampies From Morning Until Night In A Lockdown Fuck Fest Nene Tanaka

  • nene tanaka censoredcreampiebig titsMIAAmoodyztequilia tinoeveryone s porn starMIAA-402MIAA402miaa00402
    • 2021-03-25
    185 min

    [NHDTB-508]Confined Room Seduction Women Are Confined With Nowhere To Run To And Brought To Orgasm Over And Over!

  • censoredsquirtingdeepthroatNHDTBnatural highjanken kotamaNHDTB-508NHDTB5081nhdtb00508
    • 2021-03-26
    57 min

    510ELLO-004 [Rapid rise] There is a report of obedient Sase junior.

  • amateur censoredamateurbeautiful girlelloello-004ello004510ello-004
    • 2021-04-09
    137 min

    [MKMP-393]I've Been Getting Fucked Raw By My NEET Step Brother At Home Every Day Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsMKMPk m producegory matsutamillionMKMP-393MKMP393mkmp00393
    • 2021-04-16
    67 min

    [tkwa-167]ひすい

  • amateur censoredcreampieschoolgirltkwatkwa-167tkwa167tkwa-167
    • 2021-04-16
    110 min

    [MXGS-1179]Fucking For Two Hours While Her Boyfriend's Out - Video Record Asuka Momose

  • momose asuka censoredcreampiebeautiful girlMXGSmaxingMXGS-1179MXGS1179h-068mxgs01179
    • 2021-04-17
    123 min

    [CAWD-206]POV Fucking A Beautiful Girl (Part.01) Ryona-chan (Not Her Real Name) A Weekend Record Of Free Sex With A Horny Baby-Faced JD Sex Friend

  • censoredsquirtingamateurCAWDkawaiimichiru arashiyamaCAWD-206CAWD206cawd00206
    • 2021-04-18
    91 min

    300NTK-531 Indecent G Breasts Demon Kubire’s Finest Beautiful Wife Leaves Insertion In The Second Half Of The Gangbang! !! Two lewd married women x two other sticks, and the degree of ethics is 200 times! !! De Nasty Nature That Can’t Be Sh

  • amateur censoredcreampiebig titsntkntk-531ntk531300ntk-531
    • 2021-05-21
    51 min

    FC2PPV 1829302 [Personal shooting] ♀158 Nurse Mi ◯ I-chan 20 years old 23rd time Dirty little conceived bag nurse who always loses to Ojisan’s pleasure Ji ◯ Po is pregnant with unauthorized deception and vaginal cum shot! (LOL)

  • amateur uncensoredfc2
    • 2021-05-28
    124 min

    [ECB-145]I Love My Teacher So Much I Could Eat Him Up Erina Oka

  • hill erina censoredschoolgirlsingle workECBwaap entertainmentikkyu sencobra warpECB-145ECB1452ecb00145
    • 2021-06-04

    FC2PPV 1851483 Limited number [Uncensored] Plenty of vaginal cum shot on the sensitive body of a G cup slope girl! (Part 2) This is her last work …

  • amateur uncensoredfc2
    • 2021-06-12
    121 min

    [VEO-043]Real Married Amateur's Porn Debut! She Lures Customers To Her Cafe With Her Big Tits And Big Booty - She's So Prim, Pretty, And Cute You'd Never Expect She Loves To Gobble Cock - Barista Married For 7 Years, Chiharu Ito

  • chiharu ito censoredcreampiebig titsVEOvenuspeterbornVEO-043VEO043veo00043
    • 2021-06-16
    121 min

    [PPPD-934]I Was On A Business Trip, And Because We Had To Keep Our Costs Down, I Was Booked Into The Same Room At The Inn With My Big Tits Newly Graduated Female Colleagues! We Spent The Night Sprawled On the Floor, And I Was Caught In Between Their

  • karen asahina sakura tsuji censoredbig titsslutPPPDoppaiPPPD-934PPPD934pppd00934
    • 2021-06-24
    73 min

    326HGP-026 [Tall / G Cup Big Breasts / Creampie] World-class 177cm tall slender beauty OL! Very long inseam for overseas model class! Drunk guck gaku big cum with raw insertion gun thrust that attacks sleep! !!

  • amateur censoredbig titsamateurhgphgp-026hgp026326hgp-026
    • 2021-07-27
    120 min

    [SAN-012]Drooling Slutty Wife Will Do Anything For Her Husband's Boss-Reina Shinashiro

  • pure white reina censoredcreampiebig titsSANmazakisakura kabinmother mazaSAN-012SAN012h-796san00012
    • 2021-08-21
    241 min

    [GIGL-658]What! Is She Really A MILF!？ Beauties Too Good To Be True If They Look Young They Must Be Young Down There Too! Taking A Man For Herself, She Takes His Cock All In!! 3 12 Girls

  • censoredcreampieamateurGIGLgigolo jigorogigoloGIGL-658GIGL658gigl00658
    • 2021-08-21
    61 min

    1Pondo 082121_001 I Will Teach You How To Handle The Cock In Practice! Kurumi Kokoro

  • amateur uncensored1pondo
    • 2021-09-04
    121 min

    [BADA-021]Female C***dhood Friend With A Super Masochist Wish, Maina Yuri

  • yuuri censoredsingle workBADAbarutanusubashi suidiamondBADA-021BADA021bada00021
    • 2021-09-09
    148 min

    [HAWA-259]She Gets Wet Just From Looking. 110cm Bust K-cup, 100cm Hips. Colossal Tits And Curvy Ass, Secretly Slutty Wife. "Lewd Daydream That Never Ends..." Impressive Body Takes A Hard Dick For Fucking!! Akiho-san (34 Years Old).

  • censoredbig titsHAWAkosumosu eizouhide monkcosmospictures soft on demandHAWA-259HAWA2591hawa00259
    • 2021-10-08
    120 min

    [IPX-739]24 Hour Oral Ejaculations Made Possible Through A Mobile Nurse Call System! Nympho Nurses Who Totally Love To Instantly Start Sucking Ema Futaba

  • futaba emma censoredblowjobbeautiful girlIPXidea pocketakai suiseitissueIPX-739IPX739ipx00739
    • 2021-10-08
    33 min

    FC2PPV 2315884 [Screaming Demon Squid] Thoroughly Develop A Young Body With No Experience With Toys With The Power Of Science And Continuously Cum. I Made It Into A Nasty Body That Spree With Portio.

  • amateur uncensoredfc2
    • 2021-10-22
    99 min

    [YSN-562]My New Mother-in-law Is A Devil But My Erection Won"t Go Away. Kanna Hirai

  • shiori hirai censoredcreampieblowjobYSNnonYSN-562YSN562h-127ysn00562
    • 2021-10-23
    241 min

    [SCOP-743]Legendary Hole In The Wall!! Crazy Service Investigation Highlights

  • censoredcreampieamateurSCOPscooptaro kSCOP-743SCOP743scop00743
    • 2021-10-24
    95 min

    522DHT-0306 Kasumi (Pseudonym) 31 Years Old (Naoko Akase) Who Is No Longer Invited By Her Husband Who Has Been Refused By Her Husband

  • amateur censoredcreampiemarried womandhtdht-0306dht0306522dht-0306
    • 2021-11-09
    37 min

    C0930 ki211109 Noriko Ichikawa 44years old

  • amateur uncensoredc0930



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download