javcensored beautiful girl high vision censored jav




FC2ABWAUKGPPPDCAWDHDKAMIAAFSDSSDASDSSNICHRVPREDHNDSQTEMVSDVENXMIDVWAAAGMEMLULUSSIS

2020-10-27
131 min

[KNMB-005]All Bareback Style @ Creampie Hot Spring Adventure With Mako #TogetherWithNoRubber Sexual Travelogue Mako Shion

  • miko shion censoredcreampiebeautiful girlKNMBfirst star100 raw styleKNMB-005KNMB005h-491knmb00005
    • 2020-10-27
    244 min

    [SDJS-094]SOD Female Employees Would You Please Enter The Men's Bathhouse Wearing Only A Towel？ These 4 Newly Graduated Female Employees Have Just Joined The Company, And They're Now Taking The Challenge Of A Lifetime Everyone Gets Fucked In

  • censoredbig titsbeautiful girlSDJSsod createevening editionsod female employeeSDJS-094SDJS0941sdjs00094
    • 2020-10-27
    206 min

    [HONB-192](Video) I Met This Ultra, Ultra High-Level, Super Cute Beautiful Girl At The Park And She Seriously Gave Me A Hard On And I Took Her To The Bathroom And She Sucked My Dick And I Ejaculated A Massive Cum Face Semen Splatter On Her (# ^ ^ #)

  • censoredcreampieuniformHONBmercurythe first shibuya special f e headquarHONB-192HONB192h-1133honb00192
    • 2020-10-25
    143 min

    [DBER-084]The Lusty Beast Hunting Club - An Alluring Beautiful Girl Gets Fucked To Hell - Sadness And Shame Ver. Part 6: This Young Lady Cums Endlessly, Over And Over Again, As She Submits Her Soft Skin To The Insane Pleasures Of Bondage Sachiko

  • sachiko censoredbig titsschoolgirlDBERbabyentertainmentkikubonred babeDBER-084DBER084dber00084
    • 2020-10-25
    182 min

    [HPOW-004]Parents Will Cry With Shame After Watching This Video Vol.4 Loving And Lovestruck Sex With A Short Busty S********l An Amateur Girl With The Power To Attract Men / Teenage / A Beautiful Girl / Lovey-Dovey Sex / School Uniform / Clothed Sex

  • censoredbig titsschoolgirlHPOWamateur seduction daydream familyHPOW-004HPOW004hpow00004
    • 2020-10-25
    212 min

    [HPOW-003]Parents Will Cry With Shame After Watching This Video Vol.3 Loving And Lovestruck Sex With A S********l With Divine J-Cup Titties An Amateur Girl With The Power To Attract Men / Teenage / A Beautiful Girl / Lovey-Dovey Sex / Big Tits / Scho

  • censoredbig titsschoolgirlHPOWamateur seduction daydream familyHPOW-003HPOW003hpow00003
    • 2020-10-25
    233 min

    [HPOW-002]Parents Will Cry With Shame After Watching This Video Vol.2 Loving And Lovestruck Sex With A S********l With J-Cup Colossal Tits An Amateur Girl With The Power To Attract Men / Teenage / A Beautiful Girl / Lovey-Dovey Sex / Big Tits / Schoo

  • censoredbig titsschoolgirlHPOWamateur seduction daydream familyHPOW-002HPOW002hpow00002
    • 2020-10-25
    125 min

    [BLOR-154]A Prim And Proper And Rational Legal Lolita Babe She Kept Saying No, But She Was Twitching And Throbbing With Pleasure Her Eyes Were Welling Up With Desire, And She Was Drooling For Cock!

  • censoredbeautiful girlBLORbroccoli mousouzokubroccoliBLOR-154BLOR154blor00154
    • 2020-10-24
    149 min

    [HND-897]A Blowjob Is Not Enough... While Her Husband Is Away On An Overseas Business Trip, She Had A Fucking Good Time And Came Back For Seconds In This Adult Video For Her First Raw Creampie Fuck Fest Moe Aisu

  • aisu moe censoredcreampieblowjobHNDhon nakamichiru arashiyamaHND-897HND897hnd00897
    • 2020-10-24
    169 min

    [CAWD-131]Hidden Camera Footage Of Nagoya's Number 1 Call Girl Miu Konoha! She Came To The Capital For Seduction! This Sex Industry Star Is Ready For Her Porn Debut

  • miu konoha censoredbeautiful girlsingle workCAWDkawaiibungo maedaCAWD-131CAWD131cawd00131
    • 2020-10-24
    119 min

    [CAWD-129]My Girlfriend's Little Sister Is Excessively In Love With Me, And She Turned On Her Innocent Charms To The Max And Lured Me To Temptation And I Totally Fell For Her Trap During 5 Days Of Glorious Fucking Yui Amane

  • amane yui censoredschoolgirlbeautiful girlCAWDkawaiitiger kosakaiCAWD-129CAWD129cawd00129
    • 2020-10-24
    168 min

    [HND-896]Raw Creampie 1000 Days After Deciding To Be A Porn Actress Hana Shirato

  • white peach censoredcreampieblowjobHNDhon nakamametaro mamezawaHND-896HND896hnd00896
    • 2020-10-24
    120 min

    [DASD-745]My Little Stepbrother Transformed Into A Slender And Beautiful Woman, And I Got So Horny That I Overcame Any Difficulties I Had With The Situation And Fucked His Brains Out. Sara Aizawa

  • aizawa sara censoredbeautiful girlsingle workDASDdasrokusaburo mishimaDASD-745DASD745dasd00745
    • 2020-10-24
    119 min

    [HND-902]On Vacation With My Girlfriend And Her Best Friend... We Shared A Room, And When I Got Busy With My Girlfriend It Made Her So Horny That She Seduced Me Into Creampie Sex Until Dawn Rin Kira

  • kira rin meiko nakao noa censoredcreampiebeautiful girlHNDhon nakaryo inugamiHND-902HND902hnd00902
    • 2020-10-24
    119 min

    [HND-904]I Have A Secret Technique Of Pretending To Be A Cherry Boy So That I Can Get Sex, But This Delivery Health Call Girl Caught On And Turned The Tables On Me Slut Shaming Creampie Sex Nene Tanaka

  • nene tanaka censoredcreampiebig titsHNDhon nakarakudaHND-904HND904hnd00904
    • 2020-10-24
    150 min

    [DASD-746]If You Didn't Know That This Natural Airhead Beautiful Girl Was A She-Male, And She Hit You Up With A Reverse Pick Up, Would You Go Along With Her？ Rui Nanase

  • nanase rui censoredbeautiful girlsingle workDASDdashajime yanaiDASD-746DASD746dasd00746
    • 2020-10-24
    128 min

    [DASD-753]My Mother-In-Law Seriously Pisses Me Off. A Young Wife Has A Great Idea For Getting Revenge. "Father-In-Law, May I Toy With Your Cock As I Please？" Hinako Mori

  • hinako mori censoredbeautiful girlslutDASDdaschinpo dazaiDASD-753DASD753dasd00753
    • 2020-10-24
    164 min

    [DASD-744]Semen Loving, Semen Addict Transsexual - Yura Tenshi

  • angel yura censoredblowjobbeautiful girlDASDdasnao masakiDASD-744DASD744dasd00744
    • 2020-10-24
    117 min

    [NNPJ-407]I'll Pay One Month's Worth Of Your Rent, So Can I Cum Over？？ This Trade School S*****t Had Her Guard Up But Her Tits Loosened Her Grandpa Is An American! An Athletic, Quarter-Japanese Basketball-Loving Girl With Beautiful Big Tits I

  • censoredblowjobbeautiful girlNNPJnanpa japanno directorNNPJ-407NNPJ407nnpj00407
    • 2020-10-24
    131 min

    [DASD-750]My Neighbor Fucked My Girlfriend. "An Excessively Beautiful Girlfriend Who Was Deceived By A Neighbor Who Complained About The Noise" Himari Kinoshita

  • himari kinoshita censoredcreampiebeautiful girlDASDdasrokusaburo mishimaDASD-750DASD750dasd00750
    • 2020-10-24
    118 min

    [HND-906]Calling All Amateur Boys, Welcome To The Adult Video Film Set! You'll Get To Experience The Joys Of Impregnation In A Newly Wed Lifestyle With The Popular Adult Video Actress, Amy Fukada!!

  • emi fukada censoredcreampieamateurHNDhon nakasabeth horinakaHND-906HND906hnd00906
    • 2020-10-24
    159 min

    [JUKF-050]Milking Sperm At Her Part-Time Job To Pay The Bills: Talking A Beautiful Girl Into A Bareback Fuck - Rental Girlfriend Airi-chan , Airi Natsume

  • natsume atago censoredcreampiebeautiful girlJUKFjumpjump avJUKF-050JUKF050h-227jukf00050
    • 2020-10-24
    145 min

    [CAWD-132]A Rapid Debut For A Real Young Talent Who Chose To Appear In AV Rather Than In Major Entertainment Productions - Himeka Minato

  • himeka minato censoredbeautiful girlsingle workCAWDkawaiitake dCAWD-132CAWD132cawd00132
    • 2020-10-24
    152 min

    [HND-899]A Beautiful Y********l In Uniform And A Dirty Old Man Teacher Are Gazing Into Each Other's Eyes As They Intertwine Their Tongues In An Endless, Forbidden Maze Of Continuous Creampie Sex Nozomi Ishihara

  • ishihara hope censoredcreampiebig titsHNDhon nakausa pyonHND-899HND899hnd00899
    • 2020-10-24
    120 min

    [DASD-749]Zoom IN. Transsexual Queen Natsu Asahina

  • natsu asahina censoredanalbeautiful girlDASDdashajime yanaiDASD-749DASD749dasd00749
    • 2020-10-24
    120 min

    [HND-903]I Met My Ex-Girlfriend, My First Love, For The First Time In 5 Years, And Now She Had Transformed Into An Amazingly Perverted Bitch Who Begged Me To Impregnate Her...

  • censoredcreampieblowjobHNDhon nakausa pyonHND-903HND903hnd00903
    • 2020-10-24
    144 min

    [JUKF-051]My Sister-in-law Is Cheeky!! Mitsuki-chan - Mitsuki Aya

  • aya mitsuki censoredcreampiebig titsJUKFjumpjump avJUKF-051JUKF051h-227jukf00051
    • 2020-10-24
    116 min

    [CAWD-127]My Mean Slutty Junior's Handjob I Can't Resist It Even For 1 Minute - Moko Sakura

  • sakura moko censoredcreampiebeautiful girlCAWDkawaiiamazing meatCAWD-127CAWD127cawd00127
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-23
    240 min

    [OKAX-672]Broke Bimbo: A Gal In Her School Uniform Is Short Of Money, And Apparently She's Getting By With A Horny After-School Job LOL

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-672OKAX67284okax00672
    • 2020-10-23
    129 min

    [ECB-141]Hunting Cherry Boys In Their Homes - Mitsuki Nagisa

  • scooping censoredbeautiful girlslutECBwaap entertainmentkurumi ichinosecobra warpECB-141ECB1412ecb00141
    • 2020-10-23
    302 min

    [MKMP-360]Teruta Yumemi - Dream History Classic

  • yumemi teruuta censoredcreampieblowjobMKMPk m producek taromillionMKMP-360MKMP36084mkmp00360
    • 2020-10-23
    131 min

    [BANK-018]10 Creampie Loads At An Outdoor Hot Spring - Sweet S********l With A Tiny, Tight, Pretty Pink Pussy Hikaru Minazuki

  • hikaru minazuki censoredcreampiesquirtingBANKpussy banktake chanBANK-018BANK018h-1495bank00018
    • 2020-10-23
    130 min

    [CSCT-011]Devilish Girl Infinite Shots Edition

  • scooping nene tanaka censoredcosplaybeautiful girlCSCTtmacoscraftCSCT-011CSCT01155csct00011
    • 2020-10-22
    93 min

    [OKS-098]Wet And Shiny, Perfectly Fitting Godlike Swim Suit: Horikita Tsumugi. Enjoy These Cute S*********ls' Swimsuits! This AV Starts With A Voyeur View Into A Changing Rom, And Ends With Close-ups Of Fetishes Such as Shaved Pussies, Hair Stick

  • horikita tsumugi censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-098OKS0981oks00098
    • 2020-10-22
    121 min

    [MILK-092]100cm Overwhelming Big Ass, Weird But Cute, A Plump Girl's Mad Sexual Intercourse - Haruna

  • censoredamateurbeautiful girlMILKmilkMILK-092MILK092h-1240milk00092
    • 2020-10-22
    127 min

    [DAYD-041]Lewd Home Visit With The Class's Number One Cutie Masochist - Attendance #7! Sara Kagami

  • kagami sara censoredcreampieschoolgirlDAYDpuberty fictiondaydreamDAYD-041DAYD041h-1215dayd00041
    • 2020-10-22
    128 min

    [SHIC-192]Colorless, Transparent Masochistic Daughter

  • censoredcreampiebeautiful girlSHICadolscence.comno directorSHIC-192SHIC192h-839shic00192
    • 2020-10-22
    125 min

    [FSDSS-115]My Girlfriend's Younger Sister Is A Little Devil SK**led At Getting You To Like Her - Yume Nikaido

  • nikaido yume censoredbig titsbeautiful girlFSDSSfalenosatoshi maedafaleno starFSDSS-115FSDSS1151fsdss00115
    • 2020-10-22
    150 min

    [FSDSS-117]Fresh Face Super Friendly College Girl AV DEBUT - Ena Satsuki

  • ena satsuki censoredbig titsbeautiful girlFSDSSfalenowild sevenfaleno starFSDSS-117FSDSS1171fsdss00117
    • 2020-10-22
    138 min

    [MILK-093]This Handsome Guy Sweet Talked An Angelic Shy Girl At A Tennis School And After Fucking Her, Sold The Footage As An Adult Video Without Her Permission She's An Innocent, Neat And Clean Obedient Babe But She's Super Sensual With A Fu

  • censoredamateurcosplayMILKmilkMILK-093MILK093h-1240milk00093
    • 2020-10-22
    133 min

    [SHIC-193]A Big Titted Teen Is Not At Home Right Now: Director's Cut Final Edition

  • censoredcreampiebig titsSHICadolscence.comSHIC-193SHIC193h-839shic00193
    • 2020-10-22
    140 min

    [MILK-091]Bottoms Up For 9 Hours - Tipsy, Dazed Orgasmic Sex Until Dawn Riona Minami

  • rina minami censoredbeautiful girlsingle workMILKmilkno directorMILK-091MILK091h-1240milk00091
    • 2020-10-22
    302 min

    [SVDVD-823]Shame! Naked Youth Strength Measurement 2020

  • nene tanaka kurumi ito censoredbeautiful girlSVDVDsadistic villageista girl and her shameSVDVD-823SVDVD8231svdvd00823
    • 2020-10-22
    483 min

    [FCDSS-004]Innocent Gravure Constriction E-cup Minami Ikuta BEST All 8 Titles, 8 Hour Special

  • ikuta minami censoredbeautiful girlsingle workFCDSSfalenoFCDSS-004FCDSS0041fcdss00004
    • 2020-10-22
    65 min

    [SHIC-191]Even Though She Is A Super Sexy Girl With Crazy Aureolas, I Still Think It's Early To Put It In Her

  • censoredbig titsamateurSHICadolscence.comno directorSHIC-191SHIC191h-839shic00191
    • 2020-10-21
    82 min

    [PPMNB-102]Youth I-shaped Balance/Ryoka Mizuhara

  • censoredbig titsbeautiful girlPPMNBintec incPPMNB-102PPMNB102h-706ppmnb00102
    • 2020-10-20
    131 min

    [STARS-279]"I Won't Get To See You Again For A Month..." Horny Girlfriend In A Long Distance Relationship With Her Guy Wants Her Fill Of Creampies For The Road - Loving, Intimate Sex All Night Long Mana Sakura

  • mana sakura censoredcreampiebig titsSTARSsod createnamero ajinosod starSTARS-279STARS2791stars00279



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download