jav sailor suit high vision blowjob




FC2NACRSANCESDJUFEMEYDMARAAVSAATIDHDKAVEMAADNSTARSAUKGNGODKSBJNNPJSPRDAUKGIPXHUNTB

2020-09-20
121 min

[JUL-327]This 29-Year Old Married Woman Has A Husband Who Has Been Posted Far Away, So Now She's Got Her Own Adultery Sex Routine Miho Tono

  • miho tsuno censoredmature womansingle workJULmadonnacaptain orionJUL-327JUL327jul00327
    • 2020-09-21
    109 min

    [XVSR-554]A One-Year Anniversary Of Her Exclusive Signing A Shaving Documentary Shaved Pussy x Bushy Bush Lesbian Series Kotone Suzumiya Miku Abeno

  • kotone suzumiya miku abe censoredsquirtinglesbianXVSRmax asono kancalenXVSR-554XVSR554xvsr00554
    • 2020-09-27
    154 min

    [DBER-083]Beautiful Girl Cums Like Crazy - Bound By Ruthless Doms, Innocent Hotties Made To Orgasm Until They Can't Take It Anymore RED BABE ULTRA MOVIES

  • censoredbeautiful girlbdsmDBERbabyentertainmentred babeDBER-083DBER083dber00083
    • 2020-10-03
    241 min

    [JBD-259]Upper Limit Fuck PREMIUM

  • yuri mochida hotaru mori censoredanalJBDattackersfubuki sakurajabakuJBD-259JBD259jbd00259
    • 2020-10-29
    62 min

    336KNB-126 Caress the young wife who is unsatisfied with the rut SEX with her husband. The fascinating whip and nice ass are nailed so that they can be popped with each piston! !! I will take a gonzo with this married woman from now on. 22 at Nanasat

  • amateur censoredmarried womanamateurknbknb-126knb126336knb-126
    • 2020-11-27
    39 min

    480FRIN-009 《Personal shooting》 Beautiful talent drama starring actress 20 years old “HS” drug sex video leaked

  • amateur censoredbig titsamateurfrinfrin-009frin009480frin-009
    • 2020-12-06
    241 min

    [GENM-064]Total Takami: Milking Cum Is Her Forte - Haruka Takami

  • haruka takami censoredslutsingle workGENMgenekigoldfish dGENM-064GENM064genm00064
    • 2020-12-22
    60 min

    275OCHA-078 Incident: E 67

  • amateur censoredamateurbeautiful girlochaocha-078ocha078275ocha-078
    • 2020-12-25
    51 min

    FC2PPV 1620204 [Personal shooting] Nice ass wife finally contacted This is the whole story of the play she wanted to spear to calm her body aches

  • amateur uncensoredfc2
    • 2021-01-06
    77 min

    [sika-001]あみ＆りか

  • amateur censoredcreampieuniformsikasika-001sika001sika-001
    • 2021-01-20
    23 min

    FC2PPV 1652882 Until tomorrow [Individual] Childcare-related workplace goes bankrupt. A wife who loses her job with her husband and is reluctantly vaginal cum shot twice by another stick

  • amateur uncensoredfc2
    • 2021-01-24
    140 min

    [KSAT-031]Super Cute Busty Slut Picked Up For A Creampie - Noa Futsuka (Pseudonym), 5' F-Cup

  • censoredcreampiebig titsKSAThard table delusion groupsixmanhard tableKSAT-031KSAT031ksat00031
    • 2021-02-11
    120 min

    [JRZE-028]First Time Filming My Affair Satomi Sometani

  • satomi someya censoredcreampiemature womanJRZEcenter villagekotaro misatojurakuJRZE-028JRZE028h-086jrze00028
    • 2021-02-12
    80 min

    [YMDS-020]Massive Cocks For Hire Anytime, Anywhere - Aya, Their Client, An Absolute Nympho With Colossal Tits - Splash Monster

  • censoredsquirtingblowjobYMDSmomotaro video publishingdukeyoung peachYMDS-020YMDS020ymds00020
    • 2021-02-20
    93 min

    300MAAN-626 [Carnivorous gals drown in the pleasures of sake pond meat forest! !! Endless screaming x climax] Flashy hair, flashy face, ass with a bite! Anyway, Imadoki gal who stands out! !! If you have alcohol, it’s all okay ♪ Drink, drink, dr

  • amateur censoredcreampieamateurmaanmaan-626maan626300maan-626
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-01
    302 min

    [DOKS-536]Long Sexy Tongue Blowjob Best Selection 11 Girls Who Love To Suck Cock 5 Hours

  • natsume atago rena kitamura censoredblowjobslutDOKSoffice k sDOKS-536DOKS53636doks00536
    • 2021-03-11
    76 min

    FC2PPV 1720976 [Virgin lotion gauze] Creampie if you endure the attack of a slender beauty for 3 minutes! Can Gachi Virgin really endure for 3 minutes？ Rare verification video! Complete appearance / Creampie [4K benefits available]

  • amateur uncensoredfc2
    • 2021-03-17
    81 min

    FC2PPV 1730738 [First time limited 1000pt off] Beautiful wife of celebrity from Hong Kong ❤️ Appearance The aircraft is "I want to H" ❤️ I do not know in overseas notation … Big breasts？ Big tits! ❤️ Enchanted by the cock after a long ti

  • amateur uncensoredfc2
    • 2021-03-18
    119 min

    [TPPN-186]Hot Newcomer's First Descent Into Porn! First Time Light Skin Amateur Takes Loads Of Cum On The Face As She Writes And Screams In Sexy Pleasure 11 Cum Shots

  • censoredamateurbukkakeTPPNteppanTPPN-186TPPN186tppn00186
    • 2021-03-30
    134 min

    [KMHRS-041]Her Unblemished Body Marked By 11 Loads Of Cum, Plus The First Creampie G*******g Of Her Life Misuzu Miyamori

  • misuzu miyamori censoredcreampieamateurKMHRSsod createkirinkimihoreKMHRS-041KMHRS0411kmhrs00041
    • 2021-04-09
    99 min

    374IMGN-002 MIYU(28)

  • amateur censoredmarried womanamateurimgnimgn-002imgn002374imgn-002
    • 2021-04-10
    127 min

    390JAC-088 [Do Slut Eye Opening x Creampie Facial Cumshot 3 Barrage] Cute Face And Yar Kota Yar! De S eyes open! Spanking to the M Men Corps! Holy water! Man tide! All you want to do! From ~ de M eyes open! Saddle tide from "Ochi ● Please insert

  • amateur censoredcreampiesquirtingjacjac-088jac088390jac-088
    • 2021-04-18
    47 min

    229SCUTE-1104 Rika (21) S-Cute Big Breasts Shaking Creampie Sex

  • amateur censoredcreampiebig titsscutescute-1104scute1104229scute-1104
    • 2021-04-30
    47 min

    H4610 ki210504 Rika Shirahara 24years old

  • amateur uncensoredh4610
    • 2021-05-21
    152 min

    [DASD-866]Sexy Thick Body File Of A Girl Who Won't Let Her Face Be Shown 002

  • censoredbig titsamateurDASDdashajime yanaiDASD-866DASD866dasd00866
    • 2021-06-04
    111 min

    [FTHT-015](Her G-Spot's Possessed! Orgasms Right Down To Her Womb!) The Ultimate Ecstasy! Peerless Cock Addicts Fuck Their Own Faces With Cock And Willingly Give Guys Rimjobs! Nipple Teasing And Pussy Destruction! "Let's Cum Together! Ple

  • censoredcreampieFTHTfalenodavielfalenotubeFTHT-015FTHT0151ftht00015
    • 2021-06-11
    120 min

    [IPX-670]I Hate My Boss And Would Rather Die Than Fuck Him, But During Our Business Trip, To My Surprise, We Were Booked Into The Same Room At The Hot Spring Resort Inn ... And This Disgusting, Horny Old Man Made Me Cum, Over And Over Again. Rio Kuri

  • rio kuriyama censoredbig titssingle workIPXidea pocketdishIPX-670IPX670ipx00670
    • 2021-06-12
    225 min

    [BAZX-291]Beautiful Legs, Loose Socks, Beautiful Young Woman in Uniform vol. 003

  • censoredcreampiebeautiful girlBAZXbazookatodoBAZX-291BAZX291bazx00291
    • 2021-06-17

    FC2PPV 1872931 * There are no plans to resell [Early sales end to prevent baldness] Pick up a god milk / small devil big tits gal with karaoke and take a gonzo ♪ Shake the proud odious boobs and finally decay with a high speed piston

  • amateur uncensoredfc2
    • 2021-06-19
    147 min

    [JUL-617]She Said It Was For Work: Adultery Trip Kana Yume

  • kana yui censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-617JUL617jul00617
    • 2021-06-30
    122 min

    [GVH-254]Shota-kun's Lewd Prank Series: Shota Loves Big Tits, Starring Misa Amagami

  • misa tenjo censoredbig titssingle workGVHglory questtorindoru tanakaGVH-254GVH25413gvh00254
    • 2021-07-02
    95 min

    [393OTIM-080]【妄想主観】家出美少女と性交 宇佐美雪

  • amateur censoredcreampieuniformotimotim-080otim080393otim-080
    • 2021-07-06
    51 min

    188HINT-0464 Misaki

  • amateur censoredcreampiemarried womanhinthint-0464hint0464188hint-0464
    • 2021-07-15
    100 min

    [VENX-059]Wild Horny Wife Suddenly Showed Up To Get Fucked - One Night, Two Days Of Pleasure Kana Morisawa

  • kana morisawa kanako iioka censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-059VENX059venx00059
    • 2021-07-16
    55 min

    Caribbeancom 071621-001 The most important duty of nurse is helping patients ejaculate Yui Kisaragi

  • yui kisaragi uncensoredhandjobbukkakecaribbeancom
    • 2021-08-08
    42 min

    233BAT-092 Yuuka

  • amateur censoredbig titsamateurbatbat-092bat092233bat-092
    • 2021-08-16
    76 min

    [ACZ-023]Double Hole Fisting Pet - Chika [Hard Lesbian Fucking] (Pet Collector Vol. 21)

  • censoredamateurbdsmACZsanwa publishingabnormal.companiesACZ-023ACZ023h-019acz00023
    • 2021-08-21
    158 min

    [FCDC-134]Erect Nipples Hottie Secretary Is A Tempting, Nasty Slut Who Loves To Serve! Yuuha Kiriyama

  • kiriyama yuu censoredslutsingle workFCDCweekenderFCDC-134FCDC134fcdc00134
    • 2021-08-31
    147 min

    [STARS-435]Modest Anti-Social Type Gets Lewd! Fast Pounding And Grinding! Plenty Of Creampie Loads Until There"s Nothing Left With Crazy Cowgirl Fucking! Hikari Aozora

  • aozora hikari censoredcreampieamateurSTARSsod createmaeda bungousod starSTARS-435STARS435
    • 2021-09-03
    151 min

    [MIDE-965]Squirting Cervical Orgasm Activation By Piston Fucking, Starring Nana Yagi

  • nana yagi censoredsquirtingblowjobMIDEmoodyzdoragon nishikawamoodyz divaMIDE-965MIDE965mide00965
    • 2021-09-06
    41 min

    292MY-498 Mitoma honoka 2

  • amateur censoredcreampiebig titsmymy-498my498292my-498
    • 2021-09-11
    243 min

    [UMSO-415]Devoted Blowjob With Irresistibly Eager Eye Contact! Gorgeous Older Stepsister Sucks It All Out!! 50 People

  • otsuki sound serizawa ruru censoredbig titsblowjobUMSOk m produceumanamiUMSO-415UMSO415umso00415
    • 2021-09-16
    180 min

    [ABW-144]もっと、汁 120 最大級の淫汁大噴出 野々浦暖【MGSだけのおまけ映像付き 10分】

  • amateur censoredsquirtingamateurabwabw-144abw144abw-144
    • 2021-09-17
    238 min

    [PPBD-219]The BEST Stimulating Tit-Blowjob, Where You Get Your Glans Licked While Getting A Titty Fuck At The Same Time

  • hitomi yoshine yuria censoredbig titsblowjobPPBDoppaiPPBD-219PPBD219ppbd00219
    • 2021-11-05
    166 min

    [HUNTB-132]3rd Years In Group No.4 Have A "Refreshment Booth" At The Cultural Festival... Go-go Bar 2. Private Girls" School Cultural Festival. This Mega Popular Refreshment Booth At The Annual Festival Is A Go-go Bar.

  • censoredcreampieschoolgirlHUNTBhuntermasanorihhh groupHUNTB-132HUNTB132huntb00132
    • 2021-11-19
    66 min

    SIRO-4699 [First Shot] [Whitening Young Skin] [Shaved Beauty Ma * Ko] An Active JD With An Impressive Gentle And Ephemeral Smile Has Appeared. Inexperienced Pink Color That Can Be Seen Even Through The Mosaic ○ A Meat Stick Is Put In And Out Many Tim

  • amateur censoredamateursirosiro-4699siro4699siro-4699
    • 2021-11-20
    245 min

    [SGKX-010]Document Of Personal Filming Of Gals [GALSTAGRAM BEST #007] [Shonan Choumi Monogatari SP he Gals In Swimsuits Are On A Raging 6-round Loop! It"s A 3P Of Raw, Jerking, Convulsing Sex! It"s A One-on-one Fuckfest! Double G-boobed Gal C

  • ru cha t cha censoredcreampiebig titsSGKXhame chanhajime yanaigal suta gramSGKX-010SGKX010h-1575sgkx00010



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download