jav javcensored rotor high vision censored




FC2CESDAUKSABWKSBJHUNTBADNSPRDSSISSSNINGODHDKAMIAAAVSANATRDASDSQTECAWDVENUMIDENACX

2020-10-26
84 min

[ssan-009]るーちゃん(21)

  • amateur censoredbig titsamateurssanssan-009ssan009ssan-009
    • 2020-10-29
    51 min

    [oretd-784]CHIHARU

  • amateur censoredcreampieuniformoretdoretd-784oretd784oretd-784
    • 2020-11-06
    18 min

    FC2PPV 1560542 Weekend only [Individual shooting] Prefectural Commerce Department ③ Art Department. Staying, holding hands and Gonzo (2nd round with benefits)

  • amateur uncensoredfc2
    • 2020-11-10
    73 min

    300NTK-465 On the contrary, innocent! ？？ Beautiful girl cafe clerk drinking pills! !! Checking the compatibility of your body is the most important thing before dating! !! Round up your date as soon as possible … Go to a love hotel! !! The servi

  • amateur censoredcreampieamateurntkntk-465ntk465300ntk-465
    • 2020-11-14
    20 min

    FC2PPV 1569761 First shot 19 years old JD little virgin daughter Haru virgin bitch tension virgin loss

  • amateur uncensoredfc2
    • 2020-11-19
    194 min

    [LZDQ-021]When Her Friend Urgently Urged Her To Join In, She Reluctantly Agreed To Participate In A Girls' Night Out. But The Truth Was, This Was A Regularly Scheduled Lesbian Orgy Club, And As Soon As The Party Started, She Thought To Herself, &

  • censoredbig titssquirtingLZDQlesreultimate ryorezure documentLZDQ-021LZDQ021lzdq00021
    • 2020-11-19
    120 min

    [BLK-472]Voluptuous Office Girl Cums Hard - She Punches Out At 5 For Some Creampie Overtime

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-472BLK472blk00472
    • 2020-11-27
    77 min

    [HONB-196]Shop Gal Clerk Video

  • censoredbig titsamateurHONBmercurythe first shibuya special f e headquarHONB-196HONB196h-1133honb00196
    • 2020-11-29
    212 min

    [KTKC-101]These Prim And Proper Amateur Girls Have Big Tits And Sexy Bodies Deluxe 213-Minute Edition

  • censoredcreampiebig titsKTKCkitixx mousouzokubig titsKTKC-101KTKC101ktkc00101
    • 2020-12-24
    108 min

    [FUGA-044]Soapland Brothel Reunion With My Ex-Husband - Raw Creampie Sex With The Man I Never Wanted To Fuck Again - But I Loved It Yuki Fukuda

  • yuki fukuda censoredcreampiemarried womanFUGAcenter villagesouthern earthparadise center villageFUGA-044FUGA044h-086fuga00044
    • 2021-01-05
    79 min

    451HHH-016 [Explosive Ahegao Queen! !! ] Age unknown mysterious G milk older sister. Contrary to the quiet character, it changes drastically by inserting raw cheeks! Broadcast ban It is disturbed by the last-minute sloppy face! Erection inevitable! I

  • amateur censoredcreampiebig titshhhhhh-016hhh016451hhh-016
    • 2021-01-08
    120 min

    [FSDSS-154]Beautiful Cop Addicted To Aphrodisiac Orgasms Suzume Mino

  • suzume mino censoredbig titssingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-154FSDSS1541fsdss00154
    • 2021-01-08
    55 min

    [tkwa-149]もね

  • amateur censoredamateurtkwatkwa-149tkwa149tkwa-149
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    49 min

    FC2PPV 1683388 [Personal shooting] The beauty receptionist of a department store has drastically reduced her work, and she is desperate to earn living expenses! [Creampie]

  • amateur uncensoredfc2
    • 2021-02-13
    48 min

    H4610 ori1748 Saaya Nagato 20years old

  • amateur uncensoredh4610
    • 2021-02-20
    48 min

    H0930 ki210221 Izumi Hori 30years old

  • amateur uncensoredh0930
    • 2021-03-02
    94 min

    FC2PPV 1708136 [No x Graduation Hakama] Date & Sex in Hakama … What on earth are you graduating …!？ (NO.007 Naughty-chan / Complete) “Personal shooting / Gonzo”

  • amateur uncensoredfc2
    • 2021-03-18
    47 min

    285ENDX-335 A slender beauty with a wonderful smile. A spoiled female college student who looks like this and loves older men! The Y-shaped spread legs are amazing!

  • amateur censoredcreampieamateurendxendx-335endx335285endx-335
    • 2021-03-21
    157 min

    [CJOD-286]Massage Parlor Where A Big Titty Beauty Whispers Dirty Talk Into Your Ear And Lets You Cum Inside Of Her Yukino Nagisa

  • yukino nagi censoredcreampiebig titsCJODchijo heavenhirokoji osakiCJOD-286CJOD286cjod00286
    • 2021-04-17
    61 min

    HEYZO 2500 Hot Slut Babe Really Loves Anal Drilling – Momoka Ogawa

  • momoka ogawa uncensoredcreampieheyzo
    • 2021-04-22
    32 min

    FC2PPV 1782452 Limited number [Individual shooting] Prefectural general course ② 170 cm beautiful leg girl. Gonzo before the part-time payday. Looks strong and hurts and panting

  • amateur uncensoredfc2
    • 2021-05-01
    120 min

    [JUL-557]Ririko Kinoshita Is Lifting Her Lesbian Series Ban!! During The 3 Days While My Husband Was Away On Business, My Body Was Transformed And Now I Can Only Love Lesbian Ladies. Ririko Kinoshita Yu Shinoda

  • kinoshita rinko shinoda yu censoredbig titslesbianJULmadonnamametaro mamezawaJUL-557JUL557jul00557
    • 2021-05-18
    59 min

    FC2PPV 1823328 [No] Emergency appearance of an active hostess! !! Enjoy a slippery body that you can not usually hold no matter how much money you spend, and a large amount of vaginal cum shot! [Individual shooting]

  • amateur uncensoredfc2
    • 2021-06-12
    161 min

    [CEMD-020]Embarassing! Extreme Shame Survival! Walking Naked Through The City With A Remote-Controlled Vibrator Inside - Wan Horikita

  • horikita wan censoredcreampiemature womanCEMDceleb no tomoCEMD-020CEMD020cemd00020
    • 2021-06-29
    60 min

    HEYZO 2555 Foursome Fantasy With A Flat-chested Girl! – Yuka Ohashi

  • yuka ohashi uncensoredcreampiehandjobheyzo
    • 2021-07-14
    55 min

    494SIKA-095 3P Saddle A Desire Throat Lewd Gal With A Big Cock

  • amateur censoredamateurbukkakesikasika-095sika095494sika-095
    • 2021-07-28
    60 min

    Caribbeancom 072821-001 Quick Shooting: The Best Of Momoka Ogawa Momoka Ogawa

  • momoka ogawa uncensoredcreampiehandjobcaribbeancom
    • 2021-08-03
    58 min

    FC2PPV 1743350 [Personal Shooting] Natural Material Shaved Beauty Big Tits Pichi Pichi 18 Years Old Miori-Chan Has A Large Amount Of Raw Vaginal Cum Shot!

  • amateur uncensoredfc2
    • 2021-08-09
    45 min

    FC2PPV 1977077 [Apology] Until It Disappears, It Will Be Sold At 1480pt * Actually, It Was Planned To Be Sold At 3980pt.

  • amateur uncensoredfc2
    • 2021-08-20
    240 min

    [MGDN-159]Stepmom Feast 4 Hours, Stepson Makes Her Cum...

  • sugawa yuzuki mari aso censoredmarried womanmature womanMGDNstar paradisemegadonMGDN-159MGDN159h-254mgdn00159
    • 2021-08-21
    57 min

    H4610 ki210822 Chika Yoshimoto 33years old

  • amateur uncensoredh4610
    • 2021-08-21
    149 min

    [CEMD-048]First Anal! Aisha Yuzuki - Her Whole Thick And Curvy Body Gets Penetrated In Every Hole By Thick Objects Thrusting Away! Her Expanding Asshole Starts Making Lewd Noises!

  • yuzuki aisha censoredbig titsmature womanCEMDserebu no tomoCEMD-048CEMD048cemd00048
    • 2021-08-31
    55 min

    Caribbeancom 083121-001 BOGA x BOGA: Miku Aoyama Praises Me

  • miku aoyama uncensoredcreampiehandjobcaribbeancom
    • 2021-10-08
    477 min

    [OFJE-333]100 Of The Best Super High-Class Sex Clubs, Staffed By S1 Idols 100 Repeat Business Guaranteed!! A Best Hits Collection Filled With The Ultimate Services, Backed By The Greatest Nookie Skills

  • yua mikami anzai rara censoredhandjobOFJEs1 no 1 styleOFJE-333OFJE333ofje00333
    • 2021-10-27
    39 min

    FC2PPV 2374790 First Shot! !! Limited Number! [Uncensored] "I Can’t Do Anything With My Classmates …" A Beautiful Girl With Twin Tails Is Forced To Obscene In The Park Next To Outdoor Obscenity! !! Bring It To A Closed Room And Make

  • amateur uncensoredfc2
    • 2021-10-30
    115 min

    [MKON-065]Super Serious Girlfriend That Refuses To Have Sex Goes On A Study Trip And Ends Up Sharing A Hotel With Horny College S*****ts For Wild Sex. Hinako Mori

  • hinako mori censoredcreampieuniformMKONkaguya hime pt mousozokuyumesaki ichiroumikonMKON-065MKON065mkon00065
    • 2021-11-12
    120 min

    [EYAN-179]Dangerous Days Trying To Impregnate Beautiful Plump Wife With Multiple Creampies While Husband Away. 36 Hours. Rin-san 22-Years Old.

  • censoredbig titsEYANe bodyakai suiseihanazakari no tsumatachiEYAN-179EYAN179eyan00179
    • 2021-12-10
    108 min

    [ROE-029]Living Together With My Mother-in-law In The Middle Of Summer, She Exposes Her Defenseless Body To Me. Honami Matsushima

  • honami matsushima censoredcreampiemature womanROEmadonnahiroyuki kimuramonroeROE-029ROE029roe00029
    • 2021-12-23
    123 min

    [FSDSS-337]"Want To Chug A Few More At My Place Before You Leave？" Sweet Temptation From A Female Co-worker After Missing The Last Train Home... Spilling Out Of Her Loungewear And No Bra On Her Big Tits, I Knew It Was Wrong Beforehand, But We

  • nikaido yume censoredbig titssingle workFSDSSfalenogoemonfaleno starFSDSS-337FSDSS3371fsdss00337
    • 2021-12-29
    43 min

    H0930 ki220104 Masako Kurosawa 34years old

  • amateur uncensoredh0930
    • 2022-01-13
    117 min

    [FSDSS-348]Squirting Until I Burn Out And Retiring From Sex. Minamo Nagase.

  • minase nagase censoredbig titssquirtingFSDSSfalenomichiru arashiyamafaleno starFSDSS-348FSDSS3481fsdss00348
    • 2022-01-14
    65 min

    328HMDN-444 [Individual] Big Breasts Beautiful Mature Woman 51 Years Old Large Company Officer Private Video Leaked Sexless With Her Husband For 10 Years. Have Young Subordinates With Excessive Libido Process Sexually. The Vagina Is Tightened To The

  • amateur censoredcreampiebig titshmdnhmdn-444hmdn444328hmdn-444
    • 2022-01-21
    175 min

    [URE-077]An Exclusive I-Cup Titty Beautiful Mature Woman Gets Some Dominating Breaking In Training!! Based On A Story By: Ko Takasugi Like Flies To Honey A Big Tits Wife Gets Fucked By A Younger Man And Lets Him Domesticate Her The Filthy Fate Of A B

  • rui ogasawara censoredbig titsmature womanUREmadonnakitorune kawaguchiure.comiURE-077URE077ure00077
    • 2022-01-23
    55 min

    413INST-203 [Misya ○ Maga Leaked] Cuteness Max (New 18 Years Old) Date With Him Immediately After The Grand Prix Vote Leaked Gonzo Creampie His Paipanmanko Personal Shooting [Handling Precautions] (Kana Nakada)

  • amateur censoredcreampieamateurinstinst-203inst203413inst-203
    • 2022-01-28
    100 min

    [YSN-567]The Ejaculation Control of Yuri Honma

  • really censoredcreampiebig titsYSNnonYSN-567YSN567h-127ysn00567
    • 2022-02-04
    141 min

    [SSIS-324]Mixed Body Fluids, Deep Sex: Complete No-cut Special - Ria Yamate

  • ria yamate censoredbig titssingle workSSISs1 no 1 stylemon cSSIS-324SSIS324ssis00324
    • 2022-02-05
    162 min

    [CEMD-121]キャンピングカーでエッチしようよ！4 森沢かな ～テントでトイレで車の中で！森沢かながSEXしまくる小旅行！

  • kana morisawa kanako iioka censoredcreampiemature womanCEMDceleb no tomoCEMD-121CEMD121cemd00121



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download