jav javcensored over hours censored married woman




FC2AUKGMIDVGVHMEYDIPXNACXHMNCHRVHNDDASDNATRCAWDWAAADTTSANMIAAHDKAAPODAUKGPPPD

2020-10-03
40 min

FC2PPV 1521941 [Personal shooting] A plump 38-year-old mature wife who is continuously vaginal cum shot leaves herself to numbing pleasure …

  • amateur uncensoredfc2
    • 2020-10-05
    68 min

    SIRO-4276 [First shot] [Yurufuwa JD] [Yukimi Breasts x Yuki Nice Bottom] Surprisingly inexperienced little devil face plump JD. If you give a cute girl who is fluffy both in speaking style and body a stimulus that you have never experienced before &#

  • amateur censoredbig titssquirtingsirosiro-4276siro4276siro-4276
    • 2020-10-09
    47 min

    FC2PPV 1528143 [Personal shooting] Maho 22 years old G cup big breasts plump plump shaved daughter mass cum shot

  • amateur uncensoredfc2
    • 2020-10-30
    30 min

    483HMHI-593 Shiitakechan

  • amateur censoredbig titsamateurhmhihmhi-593hmhi593hmhi-593
    • 2020-11-06
    58 min

    480FRIN-006 《Personal shooting》 Entertainer 25 years old Free announcer Tall model “AK” Fujite ● SEX leaked video with a talented producer

  • amateur censoredmarried womanamateurfrinfrin-006frin006480frin-006
    • 2020-11-07
    240 min

    [YLWN-140]When I Showed My Hard, Frustrated Cock To A Nurse While I Was In Hospital, She Unexpectedly Helped Me To Release My Sperm! 4 Hours

  • censoredamateurnurseYLWNyellow moonpappan tateishiYLWN-140YLWN140ylwn00140
    • 2020-12-02

    FC2PPV 1592219 Limited [No] Supporting the egg of a voice actor who came to Tokyo for a dream, continuous vaginal cum shot (47 minutes)

  • amateur uncensoredfc2
    • 2020-12-05
    61 min

    Pacopacomama 120520_394 Kanae Koizumi

  • kanae koizumi uncensoredblowjobpacopacomama
    • 2020-12-11
    242 min

    [MGT-128]Pick Up Amateurs On Street Corners! Vol. 95 "Introduce Us To A Friend Who's Even Sluttier Than You!" 15

  • censoredcreampiebig titsMGTprestigemegatraMGT-128MGT128118mgt00128
    • 2020-12-12
    119 min

    [DASD-774]My Lady Boss Is A Kissing Fiend. When She Snuggles Up To Me, It Blows My Mind. Yu Shinoda

  • shinoda yu censoredcreampieblowjobDASDdaskawajiriDASD-774DASD774dasd00774
    • 2020-12-18
    100 min

    [KYUN-004](For Streaming Editions Only) #Heart-Pounding Excitement 004/Aya/23 Years Old/Occupation: Beauty Salon Employee

  • censoredcreampiesquirtingKYUNprestigekyunKYUN-004KYUN004118kyun00004
    • 2020-12-26
    146 min

    [MIDE-865]Straight Up, Sure-Thing Sex With You Shameful NTR She Was About To Get Married, And This Middle-Aged Old Man Who Had Known Her Since She Was A Little Girl And Watched Her Grow Up Pumped Her Full Of Aphrodisiacs And Got Her Hooked On His Coc

  • hatsukawa minami censoredcreampiesingle workMIDEmoodyzmoodyz divaMIDE-865MIDE865mide00865
    • 2021-01-09
    27 min

    H4610 ki210109 Self Shot

  • amateur uncensoredh4610
    • 2021-01-14
    133 min

    [SPRD-1365]Mothers in Law Want To Get Pregnant, Too. Iroha Narumiya

  • narumiya iroha censoredcreampiemature womanSPRDtakara eizohotate ikkanaleddinSPRD-1365SPRD136518sprd01365
    • 2021-01-15
    231 min

    [SIM-106]A Horny Wife Who Will Writhe And Moan With Such Rude And Crude Passion In The Afternoon, It's Simply Disgusting 2

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-106SIM106118sim00106
    • 2021-01-28
    62 min

    336KNB-139 “I want to be” refreshed “while I’m refreshing …” A beautiful wife who is about to divorce will appear on AV to release her libido! Rich milk with elasticity that does not seem to have children! Slender and d

  • amateur censoredcreampiebig titsknbknb-139knb139336knb-139
    • 2021-01-29
    50 min

    [per-360]ひまり

  • amateur censoredamateurblowjobperper-360per360per-360
    • 2021-02-05
    80 min

    FC2PPV 1668094 [Uncensored] ★ Naughty ★ After giving a massage, I got a blowjob in the open-air bath …!？ “Personal shooting”

  • amateur uncensoredfc2
    • 2021-02-06
    60 min

    210AKO-417 UMI

  • amateur censoreduniformamateurakoako-417ako417210ako-417
    • 2021-02-06
    240 min

    [DVDMS-626]Facials In The One-Way Mirror Cab - College Girls Only - The One-Way Mirror - College S*****t Amateur Real Guy-Girl Platonic Friends Challenged To Their First-Ever Thigh Sex! When The Two Of Them Are All Alone Together And Cock Rubs Clit,

  • censoredcreampieamateurDVDMSdeep sfunky hasegawathe magic mirrorDVDMS-626DVDMS626dvdms00626
    • 2021-02-07
    240 min

    [MLSM-038]Smoking Hot MILF BEST Collection Mio Kimijima 4 Hours, Slender Mature Babe With Big Tits

  • kimishima mio censoredcreampiebig titsMLSMmellow moonMLSM-038MLSM038mlsm00038
    • 2021-02-07
    150 min

    [UREL-001]Sari Kosaka Is Back

  • rin kosaka censoredcreampiebig titsURELunfinishedmichiru arashiyamaunfinished elegantUREL-001UREL001urel00001
    • 2021-02-09
    120 min

    [KTRA-273]A Slut All Over Her Stepbrother! A Super Lewd Stepsister's "How To Sex" Lesson - Aya Mamiya

  • aya mamiya censoredcreampieschoolgirlKTRAk tribeKTRA-273KTRA273h-094ktra00273
    • 2021-02-12
    270 min

    [DNW-110]No More Daddy Issues! [Tricking An Insolent Daughter To Eat Her Pussy] 04

  • censoredcreampiebig titsDNWprestigedocumentDNW-110DNW110118dnw00110
    • 2021-02-12
    244 min

    [UMSO-368]Tipsy, Horny Girl Mistakes Her Stepdad For Her Boyfriend？! Totally Unaware From Start To Finished That She's Made Him Stick His Cock Inside Her! vol. 02

  • ogawa momoka jinguji temple nao censoredbig titsmature womanUMSOk m produceumanamiUMSO-368UMSO36884umso00368
    • 2021-02-17
    481 min

    [RVG-129]"My Dick Is In Her Raw!" She Was Giving Me An Oily Pussy Grind But When My Cock Was Rubbing Up Against Her Pussy It Just Slipped Right In! This Service Didn't Allow Real Fucking But This Horny Delivery Health Call Girl Ended Up L

  • censoredcreampieRVGglory questRVG-129RVG12913rvg00129
    • 2021-02-21
    119 min

    [HND-952]A Continuous Creampie Soapland That Will Let You Give Raw Creampies - Yukino Nagisa

  • yukino nagi censoredcreampiebig titsHNDhon nakazaku araiHND-952HND952hnd00952
    • 2021-02-22
    93 min

    [NSPS-970]The Cuckold Fantasies - I Sent My Wife Around - I Want To See My Own Wife Get Fucked By My Employees: Rina Kikuchi

  • rina kikuchi censoredmature womansingle workNSPSnagae stylenagaeNSPS-970NSPS970nsps00970
    • 2021-03-03
    86 min

    435MFC-085 Gonzo with a younger killer’s beautiful busty dental assistant sister! “Do you like an aggressive and erotic older sister？” [Gonzo #Erika #24 years old #Dental assistant]

  • amateur censoredcreampiebig titsmfcmfc-085mfc085435mfc-085
    • 2021-03-12
    92 min

    [DHT-240]Beautiful Lady Luring In A Married Woman With Money And Making Her Cheat On Her Husband Keiko 38 Years Old

  • censoredmarried womanamateurDHThot entertainmentblade take leeDHT-240DHT24059dht00240
    • 2021-03-18

    FC2PPV 1731298 Limited to 21 [Uncensored] JD with one experienced boyfriend, first vaginal cum shot with sex for the first time in a long time

  • amateur uncensoredfc2
    • 2021-03-21
    120 min

    [HND-956]Can Ice Cream Shop Workers Become Porn Stars Too？ Simple And Plain Amateur Makes Her Porno Debut Minami Hamasaki

  • minami hamasaki censoredcreampiebeautiful girlHNDhon nakatiger kosakaiHND-956HND956hnd00956
    • 2021-03-26
    120 min

    [MIAA-396]Night In Shinjuku! Two Girls Played With My Sensitive Nipples And Made Me Cum Over And Over Sex From Both Sides

  • kato camellia kaoru natsuki yuka saeki censoredblowjobslutMIAAmoody srusher miyoshieveryone s kikatanMIAA-396MIAA396miaa00396
    • 2021-03-27
    81 min

    [SOAV-075]A Married Woman's Infidelity - Yura Saijo

  • yura mogami censoredbig titssingle workSOAVhitozuma engokai emmanuelleihyo kairoiSOAV-075SOAV075soav00075
    • 2021-04-02
    148 min

    [JUL-524]After Getting Continuously Fucked By My Husband's Boss, On The 7th Day, I Finally Lost My Mind ... Iori Nanase

  • iori nanase censoredbig titsmature womanJULmadonnatakeshi kogaJUL-524JUL524jul00524
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-14
    49 min

    328HMDN-362 30 of Newborn Babies Born In Japan Are Brood Parasites] Former RQ Model Married Woman 29 Years Old A Wife Who Is Seeded In 40 Minutes Away From Her Husband! A nasty housewife who is pleased with a large amount of vaginal cum shot next to

  • amateur censoredcreampiebig titshmdnhmdn-362hmdn362328hmdn-362
    • 2021-06-04
    50 min

    520SSK-007 Walnut

  • amateur censoredamateurbeautiful girlsskssk-007ssk007520ssk-007
    • 2021-06-04
    88 min

    230OREC-777 Akari-san

  • amateur censoredbig titsmarried womanorecorec-777orec777230orec-777
    • 2021-07-01
    59 min

    FCP-027 [Delivery only] I love subjectivity! !! Be careful too much! !! No waiting for ejaculation with amazing licking licking handjob! 2

  • amateur censoredamateurbeautiful girlfcpfcp-027fcp027fcp-027
    • 2021-07-17
    153 min

    [SSIS-163]Premium Edition With Unpublished Footage! Mixed Body Fluids, Deep Sex, Full No-cut Special, Saika Kawakita

  • ayaka hebei censoredbig titsbeautiful girlSSISs1 no 1 stylemon cSSIS-163SSIS163ssis00163
    • 2021-07-27
    102 min

    SHPV-001 Momoasu

  • amateur censoredamateurbeautiful girlshpvshpv-001shpv001shpv-001
    • 2021-08-06
    120 min

    [EYAN-171]美白肌の激スリム妻が夫のムキムキ巨漢上司から種付けプレスで快楽堕ち… それ見てシコる寝取られ旦那 有坂深雪

  • arisaka miyuki censoredcreampiesquirtingEYANe bodygoemonhanazakari no tsumatachiEYAN-171EYAN171eyan00171
    • 2021-08-07
    112 min

    [XRL-017]A Currently Active College Girl With A Standard Deviation Score Of Over 80 Has Amazing Hand, Foot, And Ass Technique!! Mao Watanabe

  • mao watanabe censoredsluthandjobXRLk m producereal real worksXRL-017XRL017xrl00017
    • 2021-08-15
    56 min

    FC2PPV 2028583 [Top Secret Video] Complete Appearance! A Slender Beautiful Girl Who Has Just Moved To Tokyo At The Age Of 18 And Is At The Level Of Noosaka! A Top Secret Video Of Two Consecutive Vaginal Cum Shots Before The Idol Trainee Debuts!

  • amateur uncensoredfc2
    • 2021-08-17
    45 min

    FC2PPV 2039256 Overwhelming [Uncensored] A Long-Sought Reunion Date With A Beautiful Girl Who Played The Role Of A Former Child. Continuous Vaginal Cum Shot At Home … Crossing The Line

  • amateur uncensoredfc2
    • 2021-09-03
    281 min

    [DVDMS-693]Sex-loving Step-sisters Who Love Raw Sex And Want You To Lick Their Pussies

  • momose asuka mamiya nagi censoredcreampieslutDVDMSdeepsmotofuji peroflavorsDVDMS-693DVDMS693dvdms00693
    • 2021-09-09

    FC2PPV 2179147 When I Let A Junior Yakara Ntr A Girl Who Felt Good With Me In Front Of Me, I Got The First Middle-Aged Girl In My Life. I Cannot Contact You After That.

  • amateur uncensoredfc2



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download