jav delusion group censored big tits sister




FC2SDABMIAAHODVCJODWANZCHRVDASDSQTEAWDMILKNATRMIDEFSDSSLULUJUFECESDVEMAATIDJULSTARS

2020-10-14
63 min

[NYH-042]I Haven't Had A Bath With My Stepdaughter Since She Was Little - Her Grown Up Body Got Me Hard - At-Home Adultery With Noa Noa Kawanishi

  • ai kasai censoredbig titssingle workNYHdirectorsmeow meow houseNYH-042NYH0421nyh00042
    • 2020-10-16
    240 min

    [MBM-219]First-Time Customers Welcome! This Horny Housewife Is Going Viral For Adultery Creampie Sex Into A Horny Wife's Pussy Who Has A Very Low Threshold For Sex 12 Ladies 4-Hour Special 4

  • censoredcreampieamateurMBMprestigegaro sasazukambmMBM-219MBM219118mbm00219
    • 2020-10-30
    63 min

    FC2PPV 1552352 G Breast Muscle Training Beauty] K ☆ 3 is a muscle training half girl and a former boxer man’s juice-filled limit breakthrough Gonzo SEX individual shooting! Sperm comes out from the Hiku Tsukumanko hole [Creampie

  • amateur uncensoredfc2
    • 2020-11-06
    172 min

    [SSNI-912]Yura And Izuna Love Middle-Aged Men, And Their Lecherous Father-In-Law Loves Young Hotties! Yura Kano & Izuna Maki

  • yura kanno izuna maki censoreduniformslutSSNIs1 no 1 stylemichiru arashiyamaSSNI-912SSNI912ssni00912
    • 2020-11-06
    37 min

    [ore-717]Yui

  • amateur censoredcreampieuniformoreore-717ore717ore-717
    • 2020-11-22
    149 min

    [CAWD-141]Huge Dick x G-Spot Arousal x Big Squirting Making This Luxurious Body Pulse With An Internal Vagina Orgasm Yui Amane

  • amane yui censoredsquirtingbeautiful girlCAWDkawaiisuisei akaiCAWD-141CAWD141cawd00141
    • 2020-12-04
    122 min

    [UMD-758]Hey Old Lady, Let Me Fuck You!! 6

  • oda mako rei aoki censoredbig titsblowjobUMDleodragon nishikawaUMD-758UMD758125umd00758
    • 2020-12-12
    119 min

    [MEYD-637]Today, Cum Inside Me Till I'm Pregnant... Yumi Kazama

  • kazama yumi censoredcreampiebig titsMEYDtameike gorodai omuraMEYD-637MEYD637meyd00637
    • 2021-01-12
    46 min

    FC2PPV 1641718 There are benefits! [Personal shooting] JD cosplayer Mone-chan’s real face was a slut …!

  • amateur uncensoredfc2
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    121 min

    [OKSN-315]I Polluted Our Love Nest

  • censoredblowjobOKSNabc mousouzokuokaasan.com abc daydream familyOKSN-315OKSN315oksn00315
    • 2021-01-29
    300 min

    [SABA-674]I Came Already! I'm Telling You, I've Already Cum!! No, You Can't Cum Inside Meeeee! High-Speed, Furious Piston-Pounding Strokes Unauthorized Creampie Sex 300 Minutes Of Trembling, Leg-Quaking Orgasms

  • censoredcreampieamateurSABAskyu shirotoSABA-674SABA674h-244saba00674
    • 2021-01-29
    242 min

    [MDBK-156]童顔で身体は超ボイン！！ベビーフェイスでぷるんぷるんオッパイ30人のロ●巨乳BEST240分！！

  • inaba yuuri censoredcreampiebig titsMDBKk m producek taroubazookaMDBK-156MDBK156h-1496mdbk00156
    • 2021-02-06
    42 min

    C0930 hitozuma1347 Sonomi Hijiri 27years old

  • amateur uncensoredc0930
    • 2021-02-17
    77 min

    FC2PPV 1689624 [Complete amateur 100] Aoi 20 years old, God style! Event companion, two consecutive vaginal cum shot from the beginning!

  • amateur uncensoredfc2
    • 2021-02-22
    64 min

    JRAI-008 Mine girl Mikako

  • amateur censoredamateurjraijrai-008jrai008479jrai-008
    • 2021-02-27
    30 min

    FC2PPV 1704937 AV actor Ken Shimizu ♥ The amount of sperm of a refreshing handsome guy is too great … ♥ A secret personal photo session with an amateur girl with big black eyes for the first time ♥ №69 ♥

  • amateur uncensoredfc2
    • 2021-03-02
    64 min

    Caribbeancom 030221-001 The Continent Full Of Hot Girls, File.082 Kisumi Inori

  • kisumi inori uncensoredcreampiecaribbeancom
    • 2021-03-03
    80 min

    374IMGN-001 Madoka

  • amateur censoredcreampiebig titsimgnimgn-001imgn001374imgn-001
    • 2021-03-04
    244 min

    [CVDX-438]She'll Suck Up Every Last Drop Of Semen!! Immediately After Orgasmic Creampie Sex, This Horny Old Lady Will Follow Up With A Cleanup Blowjob On His Sensitive Cock 30 Ladies 4 Hours

  • censoredcreampieblowjobCVDXcenter villageCVDX-438CVDX438h-086cvdx00438
    • 2021-03-09
    54 min

    HEYZO 2475 Married Woman With Some Stories Is Available – Nagisa Miyabi

  • nagisa miyabi uncensoredcreampieheyzo
    • 2021-03-15
    54 min

    FC2PPV 1727715 Gonzo with a 36-year-old married woman! !! Go on a hot spring trip with a very neat wife and go crazy! !! As usual, I’m fluttering and rolling! [High image quality]

  • amateur uncensoredfc2
    • 2021-03-25
    185 min

    [NHDTB-508]Confined Room Seduction Women Are Confined With Nowhere To Run To And Brought To Orgasm Over And Over!

  • censoredsquirtingdeepthroatNHDTBnatural highjanken kotamaNHDTB-508NHDTB5081nhdtb00508
    • 2021-03-27
    134 min

    [NINE-047](Rare Goods Received: Young Cutie With J-Cup Tits) Office Slut With Colossal Tits Starts A Secret Date Club - Leaked Hidden Camera Footage.

  • censoredbig titsamateurNINEmercurychateaubriand hutNINE-047NINE047h-1133nine00047
    • 2021-04-01
    54 min

    [AKDL-098](Tokyo Girls) Debut On Her Way Home From Work! This Brand New Model Glitters Like A Gem At Night! Total Innocence: She's Only Had Three Lays In Her Whole Life, Now Her Pussy Gets Pounded By A Huge Cock! Rookie Model Karen, Age 21

  • censoredamateurAKDLaquinoriaquinoriaknrAKDL-098AKDL0981akdl00098
    • 2021-04-16
    40 min

    FC2PPV 1771800 [6 shots in 34 minutes] Bring a new receptionist to the spear room and cum 2 shots 4 shots uncut cum shot cum ＃ 3

  • amateur uncensoredfc2
    • 2021-04-17
    181 min

    [AKID-083]@I Started My Sex Life!! #Takehome vol. 2

  • censoredAKIDomochikaeri mousozokumanji groupAKID-083AKID083akid00083
    • 2021-04-21
    60 min

    FC2PPV 1780259 Relieve self-restraint and release stress for both men and women! Continuous vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-05-08
    196 min

    [SABA-693]10 Of The Highest Raking Amateur Babes In Totally Exclusive Footage In This Collector's Edition! Orgasmic Piston-Pounding Dildo Masturbation, All The Way To The Hilt 8

  • censoredamateurSABAclass s amateurSABA-693SABA693saba00693
    • 2021-05-08
    61 min

    383REIW-063 Mitsuki

  • amateur censoredcreampieamateurreiwreiw-063reiw063383reiw-063
    • 2021-05-20
    130 min

    [HAVD-1008]Hot Smothering Kisses! Lesbian Sisters - They Finger Each Other's Pussies Sloppy With Spit And Love Juices And Cum Together

  • kanae lennon kagami sara censoredlesbiansisterHAVDhibinodr torihamamaniac demandoHAVD-1008HAVD10081havd01008
    • 2021-05-20
    121 min

    [FSDSS-231]For The Ultimate Masturbation Complete POV I Will Provide The Best Ever Masturbation Support Yui Shirasaka

  • yui shirasaka censoredblowjobcosplayFSDSSfalenokei isoifaleno starFSDSS-231FSDSS2311fsdss00231
    • 2021-05-21
    120 min

    [JUL-577]Married Woman Secretary's Secret Kisses And Sweaty Sex Behind Closed Doors In Her Boss's Office... The Secret To Her Swift Promotion... Legendary MILF X Director Nagae's First Work! Maiko Ayase

  • maiko ayase maria sawaguchi censoredcreampiemature womanJULmadonnanagaeJUL-577JUL577jul00577
    • 2021-06-01
    40 min

    475SKCK-033 Himena 1

  • amateur censoredanalamateurskckskck-033skck033475skck-033
    • 2021-06-02
    61 min

    422ION-0069 A Yariman Woman Awakens To A Big Cock And Is Promoted To A Cock Saffle

  • amateur censoredcreampiebig titsionion-0069ion0069422ion-0069
    • 2021-06-04
    122 min

    [HODV-21582](Complete POV) Girl With An Accent Hakata Dialect Saaya Matsui

  • saya matsui censoredcreampiesingle workHODVh m pHODV-21582HODV215825642hodv21582
    • 2021-06-17
    14 min

    HEYZO 2549 Nana’s Pussy Squirt Show – Nana Kamiyama

  • nana kamiyama uncensoredblowjobcumshotheyzo
    • 2021-06-20
    133 min

    [BLOR-171]A Gal With A Demonic Sex Drive Who Cums Like An Incredible Beast She Developed Her Big Ass To Voluptuous Levels, And Now She's Shaking It And Begging For Cock Watch Her Eyes Roll Into The Back Of Her Head As She Cums Like An Animal And

  • censoredBLORbroccoli mousouzokubroccolibroccoliBLOR-171BLOR171blor00171
    • 2021-07-01
    126 min

    [GAS-486]Unveiling The Face Of A Popular Chubby L-cup Prostitute Princess Misa Sakurai

  • misa sakurai censoredbig titssingle workGAScinema unit gasa tgasGAS-486GAS48671gas00486
    • 2021-07-03
    106 min

    390JAC-097 [Galtic God Yariman GAL x 5 Cum Shots] Thank you for waiting! You may have kept you waiting too long! !! !! This is [Erika, the 54th Gal Shibe Chief]! !! !! Fernastic half-beautiful gal is a god Yariman who repeats such a crazy request as

  • amateur censoredcreampieamateurjacjac-097jac097390jac-097
    • 2021-07-13
    60 min

    511SDK-012 [Personal shooting] Gonzo date secretly to a frustrated nympho beauty husband who masturbates in the passenger seat

  • amateur censoredamateursdksdk-012sdk012511sdk-012
    • 2021-07-14
    65 min

    495MOJ-011 "riko & Arisa" Of A Good Friend Duo With A Lesbian After School Orgy

  • amateur censoreduniformamateurmojmoj-011moj011495moj-011
    • 2021-07-20
    41 min

    H0930 ki210720 Noriko Owada 42years old

  • amateur uncensoredh0930
    • 2021-08-18
    150 min

    Caribbeancom 081821-001 Bloomers Anthology Tsubasa Miyashita, Shizuku Hatano, Mirei Yokoyama, Airi Mizusawa, Sanae Akino, Kaede Aoshima

  • amateur uncensoredcreampielesbiancaribbeancom
    • 2021-09-03
    172 min

    [BF-640]My Lady Boss At My Part-Time Job Is Consumed By Her Work And Feeling Extremely Horny, So She Lured Me To Temptation, And Made Me Cum Until The Break Of Dawn At The Hotel. Kokona Asakura

  • asakura here censoredcreampiebig titsBFbefreerokuyonBF-640BF640bf00640
    • 2021-09-10
    124 min

    [JUL-705]After The Graduation Ceremony ... Your Stepmom Is Giving You A Gift To Celebrate Your Entry Into Adulthood ... A Madonna Label Exclusive Beautiful Mature Woman Actress Is Celebrating Your Launch Into The Real World With Her Alluring Eroticis

  • hojo asahi censoredcreampiemature womanJULmadonnahimu lockJUL-705JUL705jul00705
    • 2021-10-01
    147 min

    [CAWD-292]"I Want To Have Sex During Work!" After Experiencing Sex A Year Ago Arisu Kusunoki Aged 19 Loves Sex So Much That She Made Her AV Porn Debut

  • kusunoki arisu censoredsingle workCAWDkawaiimamezawa mametarouCAWD-292CAWD292cawd00292
    • 2021-10-14
    21 min

    HEYZO 2633 Konoha’s Amazing Footjob – Konoha Kasukabe

  • amateur uncensoredblowjobheyzo



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download