jav creampie mature woman voyeur def




FC2JULAUKGCAWDAWDSQTEAVSAMVSDABWGMEMCHRVMIDEFSDSSNATRHNDSPRDMARAAPODAMBINACXAUKS

2021-01-22
121 min

[IBW-814]Beautiful Girl Fucked In A Public Toilet

  • amateur censoredbeautiful girlIBWi b worksIBW-814IBW814
    • 2021-02-01
    124 min

    [GOJU-177]"I May Be In My Fifties, But I Still Want To Keep On Fucking." She Wants To Release Her Wealth Of Sexual Knowledge, And So Now, This Beautiful Mature Woman Has Mustered Up Her Courage And Decided To Star In This Adult Video Megumi-s

  • censoredamateurmature womanGOJUfifty somethingGOJU-177GOJU177h-1165goju00177
    • 2021-02-11
    39 min

    [ore-754]ミイナ

  • amateur censoredcreampiebig titsoreore-754ore754ore-754
    • 2021-02-12
    124 min

    [EBOD-799]The World's Most Erotic Woman Is A Man-eating Slut Ad Libbing Everything

  • censoredcreampieslutEBODe bodymichiru arashiyamaEBOD-799EBOD799ebod00799
    • 2021-02-17
    120 min

    [GVH-198]A Son-in-law Targeting His Mother-in-law's Big Tits - Riko Tokushima

  • riko tokushima censoredcreampiebig titsGVHgloryyellow cherryGVH-198GVH19813gvh00198
    • 2021-02-20
    48 min

    FC2PPV 1694535 [Junior-kun ⑤] I’m alive with a Lori girl I picked up in the park! Egg blowjob face sucking on a big cock is cool (laugh)

  • amateur uncensoredfc2
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-22
    114 min

    [OPKT-028]A Forbidden Impregnation Creampie Part-Time Job Airi Shiraishi

  • airi shiraishi censoredcreampiesingle workOPKTtoyohikoOPKT-028OPKT028opkt00028
    • 2021-02-22
    131 min

    [OPPW-085]Transsexual With Super Cute Voice And Osaka Dialect Has First Crossdressing Experience And AV Debut!! Chii Fuyutsuki

  • chii fuyutsuki censoredsingle workOPPWyourOPPW-085OPPW085oppw00085
    • 2021-02-23
    72 min

    200GANA-2444 Seriously Nampa, first shot. 1602 A fashionable celebrity married woman who suffers from sexlessness even though she is a newlywed found in Omotesando! Frustrated with having sex 3 months ago! The libido that was suppressed by stimuli ot

  • amateur censoredbig titsmarried womanganagana-2444gana2444200gana-2444
    • 2021-02-25
    94 min

    485GCB-009 Docha fucking nasty Musume [Hamamao] is fully prepared! !! !! Grab the heart and crotch of a virgin with your own charm and erotic tech! !! !! The throat erotic body with the highest sensitivity is so climax & squirting that you are wo

  • amateur censoredbig titssquirtinggcbgcb-009gcb009485gcb-009
    • 2021-02-27
    62 min

    1Pondo 022721_001 Train Ryu Enami in a kimono vulgarly! Ryu Enami

  • amateur uncensored1pondo
    • 2021-02-27
    56 min

    383REIW-035 Orchid

  • amateur censoredbig titsamateurreiwreiw-035reiw035383reiw-035
    • 2021-02-27
    117 min

    [MIAA-400]They Won't Let You Stop Until You've Cum 10 Times! - This Naughty Soapland Girl Pushes Masochistic Guys Past Their Ejaculation Limits - Riho Fujimori

  • riho fujimori censoredbig titsslutMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-400MIAA400miaa00400
    • 2021-03-05
    69 min

    [pvmb-011]あみな(21)

  • amateur censoredcreampieamateurpvmbpvmb-011pvmb011pvmb-011
    • 2021-03-05
    170 min

    [ABW-062]Miss Suzumura Loves Teasing Men! My Teacher Miss Suzumura Lovingly Fucks Me Three Times In A Row! Airi Suzumura

  • suzumura airi censoredsquirtingblowjobABWprestigemichiru sunabsolutelyABW-062ABW062118abw00062
    • 2021-03-06
    158 min

    [BF-627]I Was Jealous Of My Classmate, Who Was Dating A College S*****t ... So While My Classmate Was At Home, I Spent 2 Days And A Night Furiously Fucking Her Boyfriend. Asuka Momose

  • momose asuka yuuri censoreduniformschoolgirlBFbefreeroku yonBF-627BF627bf00627
    • 2021-03-06
    45 min

    FC2PPV 1714689 [Main story face barre] <Boku Kano / Kurade> I will secretly release a private video I took while traveling to a hot spring with her part3 I can’t stop even when I wake up.

  • amateur uncensoredfc2
    • 2021-03-07
    181 min

    [MEAT-029]A Limber Body x Colossal Tits x A Huge Ass This Voluptuous Girl Is Begging To Appear In This Adult Video! 3 Sweaty, Big Dick Fucks

  • censoredbig titsamateurMEATbig fleshy road family daydreamMEAT-029MEAT029meat00029
    • 2021-03-10
    52 min

    FC2PPV 1719387 [Personal shooting] ♀ 302LJ series Yu ◯ -chan 18 years old 1st time first shot! A natural G-cup Lori busty girl who is mistaken for J © gets pregnant at the same time as graduating with a dangerous day cum shot! ？？ (LOL)

  • amateur uncensoredfc2
    • 2021-03-12
    67 min

    [orec-714]まりなちゃん

  • amateur censoredcreampieuniformorecorec-714orec714orec-714
    • 2021-03-18
    211 min

    [HUNTA-969]"If You Promise To Keep It A Secret, I'll Let You Do Whatever You Want With Me ..." I Was Refusing To Go To School, But I'm The Only One Who Knows That This Super Prim And Proper School Council President Is Secretly A Horny

  • censoredcreampieschoolgirlHUNTAhuntercognac kaminohhh groupHUNTA-969HUNTA969hunta00969
    • 2021-03-19
    60 min

    [sika-051]まどかちゃん(18)

  • amateur censoredcreampiesquirtingsikasika-051sika051sika-051
    • 2021-03-26
    170 min

    [WAAA-042]If You Can Withstand Yuzu Shirakawa's Ultimate Techniques She'll Let You Fuck Her Raw!

  • yuzu shirakawa censoredcreampieblowjobWAAAwanz factorywanzWAAA-042WAAA042waaa00042
    • 2021-03-26
    479 min

    [HRV-062]Picking Up Married Women On The Street And Bringing Them Home To Fuck SUPER BEST 30 Women 8 Hours 01 Adulterous Creampie Sex! Satisfying Sexually Frustrated Beautiful Married Women!

  • censoredcreampiemarried womanHRVprestigeharvestHRV-062HRV062118hrv00062
    • 2021-03-26
    151 min

    [JUNY-033]Chubby Slut Across The Street Who Dresses In Revealing Clothing Seduced Me! Rio Ohara

  • osamu osamu censoredbig titssingle workJUNYfitchnikuyokuJUNY-033JUNY033juny00033
    • 2021-03-28
    59 min

    [490FAND1-2]ねね 2

  • amateur censoredbig titsamateurfand1fand1-2fand12490fand1-2
    • 2021-04-11
    45 min

    FC2PPV 1750313 SARA’s rental plan ❤️ Immediate scale of other sticks ❤️ Intellectual girls who expose their faces while holding a big dick ❤️ Unbearably intruding 3P raw vaginal cum shot Many purchase benefits

  • amateur uncensoredfc2
    • 2021-04-21
    61 min

    SIRO-4496 [First shot] [Too much passed away ..] [Screaming at adult technique] A fair-skinned college student from Hokkaido challenges the adult world. The 19-year-old girl who responded to the interview with full energy .. AV application on the net

  • amateur censoredsquirtingamateursirosiro-4496siro4496siro-4496
    • 2021-05-07
    160 min

    [SUN-014]Horny Housewives (Bunny) - She Can't Survive Without Cum - Exhibitionist Seduces Dicks At A Sex Shop And Swinger's Club

  • kazama yumi censoredbig titsmature womanSUNsunbacon tanakaSUN-014SUN01413sun00014
    • 2021-05-18
    35 min

    396BIG-101 Suzutama

  • amateur censoredcreampieamateurbigbig-101big101396big-101
    • 2021-05-18
    53 min

    H0930 ki210518 Mayumi Nakagawa 43years old

  • amateur uncensoredh0930
    • 2021-05-19
    124 min

    [GVH-232]Naughty Nurses: Kokone Nakamura

  • nakamura here censoredcreampiegrandfatherGVHglory questham the mcGVH-232GVH23213gvh00232
    • 2021-05-20
    140 min

    [VNDS-5211]Amazing Mature Woman Minako Kirishima, Tempting And Sexy

  • minako kirishima censoredmature womansingle workVNDSstar paradisenext toilet r eVNDS-5211VNDS5211h-254vnds05211
    • 2021-05-25
    120 min

    [SAN-004]Adorable Young Wife With Life Skin And An Incredible Body - Real Life Calligraphy Teacher's Bold Public Fucks Marino Yura

  • haruki sato serizawa tsumugi censoredbig titslesbianSANmothermother motherSAN-004SAN004118san00004
    • 2021-06-08
    134 min

    [STARS-380]12 Loads On A Day Trip - Passionate Creampie Hot Spring Vacation Hikari Aozora

  • hikari aozora censoredsingle workSTARSsod createrakudasod starSTARS-380STARS3801stars00380
    • 2021-07-02
    13 min

    FC2PPV 1898831 [Women until recently] 18-year-old Miyu-chan and her first experience train blowjob, slimy lotion raw fuck play in a naughty swimsuit!

  • amateur uncensoredfc2
    • 2021-07-04
    50 min

    404DHT-0107 Raw Saddle Talking To A New Masseur For The First Work Of The Day! Shizuka 48 years old

  • amateur censoredamateurmature womandhtdht-0107dht0107404dht-0107
    • 2021-07-10
    122 min

    [AUKG-517]Fifty-something Lesbians - Afternoon Secret Lustful Meeting In A Love Hotel - Chisato Shoda Mio Saionji

  • shota chisato mio saizonoji censoredbig titslesbianAUKGu krentoAUKG-517AUKG517aukg00517
    • 2021-08-07
    242 min

    [NASH-551]Fakecest - The Guilty Mother In Her 50s

  • kozue tokita reiko ayukawa censoredmature womanNASHnadeshikoNASH-551NASH551nash00551
    • 2021-08-07
    171 min

    [DGCEMD-043]Digital Exclusive! Includes Free Movie, Nonstop Intense Orgasm Fuck Brings Her To Tears 12 Rin Misaki

  • miyazaki ri censoredmature womanDGCEMDcelebrity friendsDGCEMD-043DGCEMD043dgcemd00043
    • 2021-08-13
    121 min

    [TPPN-201]Yu Shinoda Is Proud Of Her Ass And Getting Her Big Ass All Nice And Sweaty And Going Cum Crazy During Deep And Rich Sure Thing Sex And Doing It All Without Any Direction Or Acting And Just Obeying Her Instinct Yu Shinoda

  • shinoda yu censoredblowjobsingle workTPPNteppanTPPN-201TPPN201tppn00201
    • 2021-08-19
    78 min

    [REBD-581]Mei2 Maybe Heaven - Mei Miyajima

  • mei miyajima censoredsingle workREBDrebeccataiga kosakaiREBD-581REBD581h-346rebd00581
    • 2021-08-21
    119 min

    [GMEM-041]Crazy Confinement Episode 04: Crazy Pussy Filled With Made Pleasure - A Female Detective"s Shameful And Nasty Awakening Satomi Suzuki

  • satomi suzuki censoredsingle workGMEMavsbaba za babiiavscollector s goldGMEM-041GMEM041gmem00041
    • 2021-08-26
    225 min

    [CHN-206]新・絶対的美少女、お貸しします。 105 七嶋舞(AV女優)20歳。 七嶋舞 【MGSだけのおまけ映像付き 15分】

  • amateur censoredamateurchnchn-206chn206chn-206
    • 2021-09-11
    120 min

    FC2PPV 2187479 [Uncensored Leak] Super Popular "Hatsumi Saki" Uncensored Raw Creampie Outflow 10 / Cum Swallowing Love Cum Rookie Luxury Soap Lady Part 1 Plenty Of 2 Hours

  • amateur uncensoredfc2
    • 2021-09-23
    119 min

    [TOEN-050]There"s Nothing To Do In The Country During Summer, And Now This Widow Is Having Sweaty Sex With Her Little Brother-In-Law, Who Has Just Cum Home, Every Day Marika Kobayashi

  • marika kobayashi censoredcreampiemature womanTOENcenter villageyoichi sanotaoyuanTOEN-050TOEN050h-086toen00050
    • 2021-09-28
    76 min

    326GCP-009 [Parent Official Compensated Dating] Creampie Sex Secretly To Mother [Anna] ~ All You Want To Do For A Pure Innocent Girl ~ (Hinano Kamisaka)

  • amateur censoredcreampieamateurgcpgcp-009gcp009326gcp-009



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download