jav censored slut javcensored




FC2HDKAROYDSANAVSAMEYDMVSDGMEMWAAASQTEEBODHNDHZGDWANZAUKSIPXJUFEVENUGVHNNPJLULU

2021-01-20
135 min

[GVH-182]Anal Teacher III: Naoko Akase/Meiko Nakao

  • naoko akase meiko nakao noa censoredanalslutGVHglory questchintaGVH-182GVH18213gvh00182
    • 2021-01-20
    123 min

    [BNST-023]Horny Slut Happily Takes Two Cocks! Wild, Friendly Nympho! Hikari, H-Cup Hikari Sena

  • hikari sena censoredbig titsBNSTteacher delusion groupkamagramBNST-023BNST023bnst00023
    • 2021-01-20
    137 min

    [OVG-162]She Shifted Her Panties Down The Hole In Her Pantyhose And Shoved My Cock In! This Slut Is Luring Me To Temptation With Dirty Talk And Riding Me For Cowgirl Creampie Sex

  • mizuki sanada hinata clan censoredcreampieslutOVGglory questOVG-162OVG16213ovg00162
    • 2021-01-20
    120 min

    [GVH-184]She Doesn't Want To Waste Any Semen, So She'll Lick It All Down For A Cum Swallowing Good Time! This Semen-Saver Mama Is Not Wasting Any Tissues And Helping Out The Environment Yuri Sasahara

  • yuri sasahara censoredslutmomGVHglory questkabin kizakuraGVH-184GVH18413gvh00184
    • 2021-01-19
    140 min

    [STARS-321]Crude Gear-Shifting Ultra High-Speed PtoM Action! Furious Gear-Shifting, Pussy-Pounding Piston Cowgirl Sex And Raw Blowjob Dick-Sucking In An Endless Loop Of Fucking And Sucking By An Ejaculation-Controlling Caregiver Elder Sister Type Bab

  • mahiro yui censoredblowjobbeautiful girlSTARSsod createkyoseisod starSTARS-321STARS3211stars00321
    • 2021-01-19
    141 min

    [SDTH-001]Cheerful Cum-Guzzling Sub Slut. She Loves Sex More Than Money - This Amateur Starred In Porn To Get Fucked. Upscale Real Estate Agent Working In Tokyo For Two Years - Cum Swallowing Yuki Mishima (Pseudonym - Age 23) Her One-Night, Two-Day P

  • censoredSDTHsod createietaroeromanceSDTH-001SDTH0011sdth00001
    • 2021-01-19
    130 min

    [SDNM-260]She Tries Her Best At Work And At Home, But She's Just So Horny - Hikaru Konishi, Age 29 - Chapter 3 - Her First Ever Night Out After A Little Liquor Leads To A Passionate Encounter

  • hikaru konishi censoredmature womanslutSDNMsod createakira saijogenuine married woman the porn experienSDNM-260SDNM2601sdnm00260
    • 2021-01-17
    108 min

    [MGMP-055]Handjob From A Slut Dental Hygienist Wearing Rubber Gloves - The Ultimate Sub Cleaning! 3

  • natsuki kisaragi yuka hirose censoredsluthandjobMGMPmegamibeautiful goddess premiumMGMP-055MGMP055mgmp00055
    • 2021-01-17
    114 min

    [DDOB-086]A Vile Mom's Max Cock Squeeze Reiko Kobayakawa

  • kobayakawa reiko censoredmature womanslutDDOBdogmatenunmy auntDDOB-086DDOB086ddob00086
    • 2021-01-17
    114 min

    [MOPT-002]Long-Legged Babe Teases Male Subs - Pantyhose, Jeans, And Knee-High Boots Narumi Hirose

  • narumi hirose censoredanalslutMOPTm o paradisemo tightMOPT-002MOPT002mopt00002
    • 2021-01-17
    133 min

    [KTKC-105]I Never Expected My Stepdaughter To Be Such A Busty Little Succubus. Hinata

  • censoredbig titsamateurKTKCkitixx mousouzokubig titsKTKC-105KTKC105ktkc00105
    • 2021-01-17
    176 min

    [MMYM-042]Slut With Huge Tits Gets You To Make Her Cum With Dirty Talk - Filthy Words - Chitose - Chitose Yuki

  • chitose in the evening censoredbig titsslutMMYMmarrionaida yumenoyumenoMMYM-042MMYM042mmym00042
    • 2021-01-17
    240 min

    [KTKY-054]She's The S*****t Council President... And A Cock-Loving Slut! The Best Combination Ever! 4 Hours

  • censoredbig titsschoolgirlKTKYkitixx mousouzokuKTKY-054KTKY054ktky00054
    • 2021-01-16
    240 min

    [HUNTA-937]"The Truth Is, I'm A Serious Slut!" This Prim And Proper Girl Is Actually Super Horny And Into Passionate, Deep And Rich Sex!! In Any Case, She Loses Her Mind With Liberating, Deep And Rich Sex!

  • censoredcreampieblowjobHUNTAhuntervolvo nakanohhh groupHUNTA-937HUNTA937hunta00937
    • 2021-01-16
    154 min

    [SSNI-967]Your Older Girlfriend Teases Your Nipples Nicely Until You Cum Ichika Hoshimiya

  • ichika hoshimiya censoredslutsingle workSSNIs1 no 1 stylegoemonSSNI-967SSNI967ssni00967
    • 2021-01-16
    120 min

    [MVSD-450]A Fated Dual Affair With The New Girl About To Resign From Work To Get Married - My Last Round Of Passionate, Creampie Sex With My Lover Before I Leave The Office Akari Neo

  • akari neo censoredcreampieslutMVSDm s video groupMVSD-450MVSD450mvsd00450
    • 2021-01-16
    118 min

    [MVSD-452]Dual Curvaceous Devils - Twin Sluts With Huge Tits Lavish Your Dick With Attention - A Succubi Sandwich

  • yukino nagi nene tanaka censoredcreampiebig titsMVSDm s video groupMVSD-452MVSD452mvsd00452
    • 2021-01-16
    120 min

    [BLK-483]A Woman So Rude And Crude, It's Disgusting We Discovered This Crazy, Voluptuous Bitch In A Back Alley In Ameyoko, And Took Her To A Love Hotel And Gave Her Raw Fucking Creampies All Day

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-483BLK483blk00483
    • 2021-01-16
    118 min

    [PPPD-900]Twin Sluts Surround A Hung Older Guy And Drain His Sperm Bank Dry! Tanned, Busty Nymphos Use Their Bondage SK**ls

  • censoredcreampiebig titsPPPDoppaiPPPD-900PPPD900pppd00900
    • 2021-01-16
    160 min

    [JJBK-039]Mature Woman Babes Only A Mature Woman Came To My Room So We Took Her Home For A Peeping Good Time And Then We Sold The Footage As An Adult Video 37 Horny Mature Woman Babes Who Use Their Tall Bodies And Beautiful Colossal Tits To Fuck Male

  • censoredmature womanslutJJBKjukujo bank emmanuellemanji groupJJBK-039JJBK039jjbk00039
    • 2021-01-16
    120 min

    [BLK-486]Fucked By Older Guys She Hates But This Slut Is Still Squirting! Bratty Blonde Teen In A School Uniform Says She Definitely Won't Cum But Ends Up Orgasming So Hard She Wets Herself - And We Got The Whole Thing On Camera!

  • censoredsquirtinguniformBLKkira kirakira kira black galBLK-486BLK486blk00486
    • 2021-01-16
    113 min

    [ROYD-037]I Confessed My Love For The First Time To The No.1 Slut At School! "If We're A Good Match Sexually, I'll Go Out With You!" And Then She Gave My Cherry Boy Cock A Test Ride! Yui Kawai

  • yui kawai censoredcreampieschoolgirlROYDroyalcognac kaminohhh groupROYD-037ROYD037royd00037
    • 2021-01-16
    150 min

    [BLK-484]Convenient Free Pussy! Fucking Raw Till Morning With A Horny Bitch Who Loves Older Men 03

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-484BLK484blk00484
    • 2021-01-16
    63 min

    418YSS-080 Ameri

  • amateur censoredamateurslutyssyss-080yss080yss-080
    • 2021-01-15
    135 min

    [REAL-755]Blowjob Princess Kurumi Tamaki

  • tamaki walnut censoredblowjobslutREALreal workstrendy yamaguchireal real worksREAL-755REAL755172real00755
    • 2021-01-15
    68 min

    [WAS-001]From Now On I'm Giving This Hot Married Slut Creampies. Picking Up Girls For Cheating Sex

  • censoredcreampieWASlotusWAS-001WAS001h-047was00001
    • 2021-01-15
    160 min

    [MDBK-152]I'll Fuck You A Door-To-Door Slut Counselor Is Giving A Work-At-Home Man Some Totally Sexual Health Care

  • satomi yuria akari shinmura censoredbig titsslutMDBKbazookak taroMDBK-152MDBK152h-1496mdbk00152
    • 2021-01-15
    243 min

    [UMSO-360]I Went To Fix This Lady's TV, And She Popped Out Completely Naked!! I Didn't Know Where To Look While Repairing Her TV, And When My Cock Got Rock Hard, Things Took An Unexpected Turn...!？ vol. 03

  • yoshikawa aimi aya takashiro censoredbig titsmature womanUMSOkm produceumanamiUMSO-360UMSO36084umso00360
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-15
    120 min

    [NATR-649]She Loves Sex! My Brother`s Too Naughty Wife!! Yume Izumi

  • yume izumi censoredcreampiebig titsNATRnadeshikobito sakuraNATR-649NATR649h-067natr00649
    • 2021-01-15
    180 min

    [DIPO-088]Top Secret Leaked Footage! Middle-Aged Guy Filmed His Affair With A Married Slut

  • censoredDIPOprimoero nandesuDIPO-088DIPO088h-283dipo00088
    • 2021-01-14
    115 min

    [ARM-942]<The Trick Is To Stick Your Tongue In As Deeply As Possible> This Is The Golden Rule At The Anal-Licking Company 3

  • really suzuka walnut censoredanalslutARMaroma planningshigeo kadowakiaromaARM-942ARM942arm00942
    • 2021-01-14
    106 min

    [ZEAA-057]Absolute Obedience Face Fuck: Married Slut Who Loves To Have Her Throat Pounded Noa Kosaka

  • kosaka censoredcreampiemature womanZEAAcenter villageamagumogoku centervillageZEAA-057ZEAA057h-086zeaa00057
    • 2021-01-13
    43 min

    230ORE-742 A sensei

  • amateur censoredcreampiebig titsoreore-742ore742ore-742
    • 2021-01-13
    37 min

    230ORE-741 Y sensei

  • amateur censoredcreampiebig titsoreore-741ore741ore-741
    • 2021-01-13
    40 min

    230ORE-743 N sensei

  • amateur censoredcreampiebig titsoreore-743ore743ore-743
    • 2021-01-12
    115 min

    [KTRA-266]Tempted Into Creampie Sex By A Big Titted Stepsister - Aoi Morinaga

  • morinaga aoi censoredbig titsuniformKTRAk tribeKTRA-266KTRA266h-094ktra00266
    • 2021-01-12
    126 min

    [GONE-026]This Lovey-Dovey Slut Is An Unattainable Flower She's Domesticating This Chubby NEET Nerd Loser Piece-Of-Shit Motherfucker Like A Stray Cat.

  • censoredcreampiebig titsGONEmercurya fair skinned elder sisterGONE-026GONE026h-1133gone00026
    • 2021-01-12
    108 min

    [HONB-202]Slime-Slathered Huge Tits - G-Cup Slut

  • censoredbig titsamateurHONBmercurythe first shibuya special f e headquarHONB-202HONB202h-1133honb00202
    • 2021-01-12
    122 min

    [KTRA-265]Creampie For My Slender S********l Stepsister Hinako Mori

  • hinako mori censoreduniformslutKTRAk tribeKTRA-265KTRA265h-094ktra00265
    • 2021-01-10
    129 min

    [MOPG-067]I'd Love It If That Girl Was The Kind Of Slut Who'd Choke Me While Teasing My Nipples. Natsuki Kisaragi

  • natsuki kisaragi censoredanalbig titsMOPGm o paradisemo goldMOPG-067MOPG067mopg00067
    • 2021-01-10
    133 min

    [KYMI-010]High-Class Slut With Big Tits Pleasures Guys Fully Clothed In A Hotel Suite - H-Cup In A High-Legged Leotard Yuri Honma

  • really censoredbig titsslutKYMImiluaida yumenoKYMI-010KYMI010kymi00010
    • 2021-01-10
    121 min

    [VEC-459]Mom's Best Friend Yumi Sakurai

  • yumi sakurai censoredcreampiemature womanVECvenussarumegami venusVEC-459VEC459vec00459
    • 2021-01-10
    126 min

    [BAHP-067]The Strongest Pussy - Real Sex With A Different Dick Every Day - 340 Fucks A Year - Her Fuckbuddy Rotation - Yuno Kaname

  • yuno kaname censoredblowjobslutBAHPbaltandaibutsu yoshidahoppinBAHP-067BAHP067bahp00067
    • 2021-01-09
    174 min

    [IPX-590]All Her Firsts - 4 Full Orgasmic Fucks - Exclusive Part 2, All 6 Scenes - Her Sexual Awakening SPECIAL Amu Amatsuka

  • amatsuka amu censoredsquirtingbeautiful girlIPXidea pocketmichiru arashiyamadishIPX-590IPX590ipx00590
    • 2021-01-09
    149 min

    [MIAA-377]Bathe Your Usachan Babes In Seed At The Creampie Reverse Soapland Brothel! -Breed Bunnies With Colossal Tits! - Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-377MIAA377miaa00377
    • 2021-01-09
    150 min

    [FFFS-024]Taking Mature Women Home! Married Women Playing With Other Guys' Cocks 21 - Tall Women With Beautiful I-Cup Tits Get Off On A Younger Guy's Dick! - Ayako-san, I-Cup, 40yo, 176cm Tall, Takes The Lead- Masumi-san, I-Cup, 45yo, 180cm T

  • censoredmature womanslutFFFSmature woman private videos emmanuellemanji groupFFFS-024FFFS024fffs00024
    • 2021-01-09
    118 min

    [MEYD-646]This Auntie Is A Former Slut And She's So Sexy That Her Super Skinny Nerdy Nephew Has Transformed Into A Sexual Monster! He's Got Her In A Super Orgasmic Pregnancy Fetish Hold From Which She Can Never Escape Yumi Kazama

  • kazama yumi censoredcreampiebig titsMEYDtameike goroMEYD-646MEYD646meyd00646



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download