jav censored slut high vision javcensored




FC2APODRBDSHKDCAWDAUKSMIDEAMBIMEYDSPRDHMNDASDGMEMHDKASSNIPREDMVSDKBISSISNNPJDASD

2020-09-12
167 min

[IPX-543]A Sadistic Slut At A Men's Massage Parlor is Making Me Cum So Hard And It Feels So Good I Could Die Minami Aizawa

  • minami aizawa censoredsquirtingslutIPXidea pocketinaballdishIPX-543IPX543ipx00543
    • 2020-09-12
    181 min

    [MIDE-822]My C***dhood Friend Is Prim And Proper And Silent And Quietly Luring Me To Panty Shot Temptation And Doing Her Best To Get My Attention Every Time I Took A Peek, She Got Excited And Her Panties Were Stained And Dripping Wet! Nana Yagi

  • nana yagi censoredbeautiful girlslutMIDEmoodyzgoemonmoodyz divaMIDE-822MIDE822mide00822
    • 2020-09-12
    118 min

    [MIDE-824]We Were Working Overtime Late Into The Night When The Air Conditioner Broke, And Now I Was Stuck In The Office With My Colleague. I Got Horny, And Then I Had Sweet, Relentless, Sweaty Sex Until The Break Of Dawn... Kana Kusakabe

  • kana kusakabe censoredbig titsslutMIDEmoodyzmametaro mamezawamoodyz divaMIDE-824MIDE824mide00824
    • 2020-09-12
    134 min

    [IPX-541]A Private Class With A Slutty Hot Teacher's Whispering Dirty Talk And Hard Cowgirl Riding Leads To Creampie Minori Hatsune

  • hatsune minori censoredcreampieslutIPXidea pocketjo asagiridishIPX-541IPX541ipx00541
    • 2020-09-12
    180 min

    [IPX-524]Charge! A One-Shot Project Actress, Anna Kami Is Going To A Hotly Rumored Sex Club And Providing Us With A Physically Demanding Undercover Report! Pinks Salons! Maso Sensual Clubs! An Aromatic Sensual Massage! She's Going To A Happening

  • anna kami censoredslutsingle workIPXidea pocketinjan kogadishIPX-524IPX524ipx00524
    • 2020-09-11
    142 min

    [REAL-742]Licking Princess - Monami Takarada

  • takarada monami censoredblowjobslutREALreal workstrendy yamaguchireal real worksREAL-742REAL742172real00742
    • 2020-09-11
    252 min

    [DNW-095]Godlike Orgasm Picking Up Real Amateurs Undercover Slut's Territory Inspection 7 Amateur Girl Pick Up Hunting!! 21

  • censoredcreampiebig titsDNWprestigedocument nowDNW-095DNW095118dnw00095
    • 2020-09-10
    201 min

    [SVDVD-814]Swim Team Sleepover - Naughty Slut With Big Tits In A Competitive Swimsuit Has Her Sensitive Nipples Teased While She Strips Down And Leads To The First Time She Ever Squirted In Her Life! After That Her Drenched Pussy Is Ready For A Hard

  • censoredsquirtingSVDVDsadistic villagesushi yokuboSVDVD-814SVDVD8141svdvd00814
    • 2020-09-09
    52 min

    [BTH-065]Cuckolded By A Slut At Home... Kana Morisawa

  • kana morisawa kanako iioka censoredblowjobsingle workBTHchobitchsuper bitchBTH-065BTH065h-1435bth00065
    • 2020-09-08
    120 min

    [SDMM-070]A Neat And Clean Girl Who Cannot Be Seduced Vs A Brainwashed Slut Bitch In A Battle To The Death! This Girl Has A Strong Defense, But I Confused Her With My Hard Cock And Now I'm Hitting Her With Unlimited Pussy Pounding Thrusts In This

  • censoredcreampieamateurSDMMsod createakira saijomagic mirrorSDMM-070SDMM0701sdmm00070
    • 2020-09-08
    135 min

    [MSFH-028]I Want To Be Tempted By This Girl. Ami Kitai

  • kiyo ami censoredslutsingle workMSFHsod createzaku araims sodMSFH-028MSFH0281msfh00028
    • 2020-09-07
    145 min

    [DPSDL-009]"You Get Hard When Somebody Touches Your Nipples... Are You A Perv？" The Married Woman Next Door Teases The Nipples Of A Guy Who Happens To Be A Total Sub - This MILF Slut Loves Every Minute Of Milking His Dick, Edging Out Every La

  • censoredamateurslutDPSDLdeep sswing nagaseDPSDL-009DPSDL009dpsdl00009
    • 2020-09-06
    119 min

    [DNJR-035]Do You Want To Have An Offline Nipple Fuck Fest？ Kurea Hasumi Shiori Kuraki

  • hasumi claire kuraki bookmark censoredbig titsslutDNJRdog daydreamersmeat and piss house prime cutDNJR-035DNJR035dnjr00035
    • 2020-09-05
    120 min

    [OBA-406]I'm Just An Old Lady, But Do You Really Want To Fuck Me...？ - Hungry Flesh Fantasy Sex With Her Husband's Co-Worker - Kyoko Harada

  • kyoko harada censoredbig titsmature womanOBAmadonnabieber gonzoobasanOBA-406OBA406oba00406
    • 2020-09-05
    478 min

    [HHAP-003]The Best Slut Collection - 20 Escaping Ladies Who Suffered Shame -

  • censoredschoolgirlHHAPapachehhh groupHHAP-003HHAP003hhap00003
    • 2020-09-05
    137 min

    [JUL-312]The Insensitive Married Woman Slut From Next Door Drove This Obsessive Compulsive Maso Man Insane Yuko Shiraki

  • shiraki yuko censoredmature womanslutJULmadonnanao masakiJUL-312JUL312jul00312
    • 2020-09-05
    120 min

    [JUL-304]My Mom's Friends Tsubaki Kato

  • kato camellia kaoru natsuki censoredmature womanslutJULmadonnajyoji kawaiJUL-304JUL304jul00304
    • 2020-09-05
    154 min

    [PRED-253]When I Went Home To Visit My Family, I Met Up With My Tanned Cousin For The First Time In Years, And She Lured Me To Temptation. She Was Bored With Her Country Life, So She Creampie Fucked Me Over And Over Again. Yuki Takeuchi

  • yuki takeuchi censoredcreampieslutPREDpremiumnao masakielegancePRED-253PRED253pred00253
    • 2020-09-04
    115 min

    [PARATHD-2989]I Met Up With My Ex At Our Class Reunion, And Fucked Her Brains Out, And Here Are The Highlights She's Filling My Nostrils With Those Married Woman Pheromones And I Can't Resist It

  • censoredmature womanslutPARATHDparadise tvPARATHD-2989PARATHD2989parathd02989
    • 2020-09-04
    188 min

    [UMD-748]Raw Creampie Wives That Spill Semen Untidily 2

  • mitani akari ririka censoredcreampieslutUMDleoUMD-748UMD748125umd00748
    • 2020-09-03
    132 min

    [ZBDD-007]Osaka Slut With Big Tits And A Big Booty - All Filmed In Her Hometown Dialect! Creampies, Face Sitting, Cock Teasing, Pounding Her Voluptuous Ass! Plus Tons Of Cum Poured Over Her Face! Totally Uned Documentary Footage Of A Real Porn Star

  • shimotsuki runa satoshi kudo censoredbig titssingle workZBDDmemorial publicationkudo mioZBDD-007ZBDD007483zbdd00007
    • 2020-09-02
    481 min

    [RVG-121]Reiko Kobayakawa BEST vol. 1

  • kobayakawa reiko censoredbig titsmature womanRVGglory questRVG-121RVG12113rvg00121
    • 2020-09-02
    132 min

    [GVH-117]A Flesh Fantasy Apartment Wife A Bored Husband And Wife Join A Swapping Swingers Club

  • roaring sound naoko yokoyama censoredbig titsslutGVHglory questpoison circleGVH-117GVH11713gvh00117
    • 2020-09-02
    135 min

    [GVH-115]W Anal Bitches 7 - Akari Niimura/Mihina

  • akari shinmura mihina azumihina mihina nagai censoredslutGVHglory questtrindle tanakaGVH-115GVH11513gvh00115
    • 2020-09-02
    120 min

    [GVH-118]The Wife Who Moved Next Door Teases Me With No Bra And No Panties! Saya Minami

  • minami saya censoredslutsingle workGVHglory questyellow cherry vaseGVH-118GVH11813gvh00118
    • 2020-09-01
    142 min

    [MSFH-027]This Amazing Slut Will Whisper In Your Ear Like An Angel And Tease You Like A Devil Riona Hirose

  • rio hirose censoredblowjobslutMSFHsod createk westms sodMSFH-027MSFH0271msfh00027
    • 2020-09-01
    193 min

    [DKSB-077]A Teacher And S*****t The Forbidden School An Ultra Deep And Rich Lesbian Series Special

  • censoredschoolgirllesbianDKSBoffice k sk s bestDKSB-077DKSB07736dksb00077
    • 2020-09-01
    159 min

    [DOKS-526]An Orgasmic Masturbation Monster 2 The Strongest Pussy-Grinding Half-Japanese Beauty Karina Nishida

  • nishida karina censoredanalsquirtingDOKSoffice k somaruDOKS-526DOKS52636doks00526
    • 2020-08-31
    69 min

    [SHH-004]A Cuckold Massage Parlor Where You'll Get Fucked While Your Wife Is Nearby She'll Sly Give You A Massage And Quietly Slip Your Dick Inside Her Pussy And Shake Her Ass With Cowgirl Sex Until You Creampie This Secretly Horny Massage Pa

  • censoredslutSHHnatural highkansukeSHH-004SHH0041shh00004
    • 2020-08-30
    125 min

    [JJAA-038]A Married Woman Takes An Employee Into The Break Room At Her Part Time Job For Some Private Fun 13

  • censoredcreampiemature womanJJAAjukujo japanJJAA-038JJAA038jjaa00038
    • 2020-08-29
    119 min

    [WANZ-976]Her Step-Parents See Her Face. Her Little Stepbrother Claims Her Ass! Her Step-Parents Can't See Her Horny Little Stepbrother Grinding Her Ass With His Cock And Cumming Over And Over Again With This Little Devil Big Stepsister Amy Fukad

  • emi fukada censoredslutsisterWANZwanz factorywanzWANZ-976WANZ976wanz00976
    • 2020-08-29
    158 min

    [JUFE-201]This Big Tits Slut Will Absolutely Look Down On You With Contempt While She Controls You With Dirty Talk The Ultimate POV JOI Experience As Your Ejaculation Is Under Her Control Elly Akira

  • aki erie arai erie yuka osawa censoredbig titsslutJUFEfitchaida yumenoJUFE-201JUFE201jufe00201
    • 2020-08-29
    147 min

    [WANZ-982]2 Gal Babes Went To A Love Hotel And Decided To Swap Boyfriends As They Competed Through Their Sexual Techniques, They Milked Them Of All Of Their Semen Until Their Cocks Could No Longer Withstand It In This Harlem Slut Threesome Fuck Fest

  • aika hina nanami hina nanase censoredcreampieslutWANZwanz factorywanzWANZ-982WANZ982wanz00982
    • 2020-08-29
    162 min

    [MIAA-310]A Total Domain With No Panties To Turn You On! A Little Devil Barely Legal Babe In Knee-High Socks Will Knock Your Erection Out With Pussy-Peeping Temptation Urara Kanon

  • hanaoto urara censoredschoolgirlslutMIAAmoodyzgoemoneveryone s porn starMIAA-310MIAA310miaa00310
    • 2020-08-29
    120 min

    [MIAA-286]Super-Assertive Older Gal Tells Me She Likes Me Every Day And Won't Stop Teasing Me Hina Nanase

  • hina nanami hina nanase censoredcreampieslutMIAAmoodyzhirokoji osakieveryone s porn starMIAA-286MIAA286miaa00286
    • 2020-08-29
    154 min

    [WANZ-968]You Can Impregnate Her!! Slutty Sexy Married Woman With Colossal Tits Is Coming For You - Julia Yoshine

  • yoshine yuria censoredcreampiebig titsWANZwanz factorywanzWANZ-968WANZ968wanz00968
    • 2020-08-29
    151 min

    [MIAA-279]The Snake Tongue This Woman Addicted To Licking Is A Long-Tongued Slut Who Loves To Suck Dick And Wrap Her Tongue Around Cocks In A Super Crazy Double Blowjob Fuck Fest!! Maria Nagai Misato Nonomiya

  • maria nagai nonomiya misato censoredbig titsblowjobMIAAmoodyzsuisei akaieveryone s porn starMIAA-279MIAA279miaa00279
    • 2020-08-28
    482 min

    [HMVF-009]Aphrodisiac Awakening! Masochist Woman Becomes Slut In Heat During POV (Working Title)

  • censoredamateurHMVFfuck photo rinet work second editionHMVF-009HMVF009h-1472hmvf00009
    • 2020-08-28
    59 min

    [WKD-032]Woman In Her Prime, Eri Akira

  • aki erie arai erie yuka osawa censoredblowjobslutWKDwaap entertainmentk westwWKD-032WKD0322wkd00032
    • 2020-08-28
    134 min

    [ECB-139]Are You... Planning On Squirting In Here？ Kaho Imai

  • natsuho imai censoredsluthandjobECBwaap entertainmentsamoaricobra warpECB-139ECB1392ecb00139
    • 2020-08-28
    68 min

    [SHYN-109]SOD Female Employees The Blowjob Cinderella Competition Seeding Group F 3 Girls Who Excessively Drool And Slobber

  • maeda oto yoko sakuraba censoredamateurblowjobSHYNsod createevening editionsod female employeeSHYN-109SHYN1091shyn00109
    • 2020-08-28
    119 min

    [XRW-911]Slut Classroom

  • censoredbig titsbukkakeXRWreal workstomimasu diranreal real worksXRW-911XRW911172xrw00911
    • 2020-08-28
    123 min

    [TYD-002]School Slut Rika Aimi

  • rumi tadami censoredschoolgirlhandjobTYDdream ticketTYD-002TYD00224tyd00002
    • 2020-08-28
    62 min

    [KBTV-011]A Slut's Friends Are Also Sluts: A Theroy

  • censoredcreampiebig titsKBTVgoing too far tvKBTV-011KBTV011h-1514kbtv00011
    • 2020-08-27
    175 min

    [DANDY-726]A Nurse With A Beautiful Ass Is Giving Some Cowgirl Care To A Man Who Has An Erection But Cannot Move While She Grinds Him In S-Curve-Shaped Thrusts vol. 3

  • june lovejoy ayaka mochizuki censoredslutnurseDANDYdandybacon tanakaDANDY-726DANDY7261dandy00726
    • 2020-08-27
    120 min

    [FSDSS-087]Limo Slut Makes A Masochistic Delivery Guy Cum With Her Technique! Sora Shiina

  • shiina sky censoredsquirtingslutFSDSSfalenosuisei akaifaleno starFSDSS-087FSDSS0871fsdss00087
    • 2020-08-27
    123 min

    [FSDSS-081]KiSSMANiA Humidity 100 Kissing Intercourse Ayaka Tomoda

  • ayaka tomoda censoredslutlingerieFSDSSfalenomusetafaleno starFSDSS-081FSDSS0811fsdss00081
    • 2020-08-27
    160 min

    [NHDTB-431]A Video Streaming Slut We're Fucking This Naughty Girl Who Makes The Use Of Justice Under The Guise Of Photography!

  • censoredsquirtingamateurNHDTBnatural highjanken kotamaNHDTB-431NHDTB4311nhdtb00431



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download