jav censored javcensored upskirt schoolgirl




FC2PPPDMIDEMIDVGMEMMEYDHMNSHKDATIDWANZSSISCESDHDKAMIAASPRDHNDBBANDASDLULUAUKGAUKG

2020-07-25
138 min

[MMUS-043]Little Provocative Beautiful Girl Devil - Rin Kira

  • kira rin censoredschoolgirlsingle workMMUSmarrionkijin kasaikcpMMUS-043MMUS043mmus00043
    • 2020-07-24
    150 min

    [MIDE-806]When Our Parents Aren't Looking, She's Luring Me To Panty Shot Temptation! This Tsundere Little Stepsister Enjoys Teasing Her Lolita-Obsessed Big Stepbrother!! Yui Shirasaka

  • yui shirasaka censoredschoolgirlsisterMIDEmoodyzgoemonmoodyz divaMIDE-806MIDE806mide00806
    • 2020-07-16
    240 min

    [HUNTA-814]"They Won't Catch Us In Here" Trying To Be Quiet While Fucking My Grown-Up Step-Niece In A Closet - Her Parents Are Right In The Next Room

  • censoredcreampieschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-814HUNTA814hunta00814
    • 2020-07-01
    120 min

    [BUBB-095]A S********l Standing On The Stairs White Panties Galore! A Complete Collection

  • censoreduniformschoolgirlBUBBeitentatsuzo fujidabukatsudoBUBB-095BUBB095436bubb00095
    • 2020-06-14
    125 min

    [ARM-878]JOI From High S*********ls In White Panties Spreading Their Pussies And Assholes Wide

  • arisaki ichika yumeno misaki censoredanalschoolgirlARMaroma planningmania satoshiaromaARM-878ARM878arm00878
    • 2020-06-11
    230 min

    [SW-708]A Youthful Offline Fuck With A S********l Who Loves Sex That He Met On Social Media 3

  • censoreduniformschoolgirlSWnatural highswitch switchSW-708SW7081sw00708
    • 2020-06-10
    126 min

    [OVG-139]Slutty Girls Ride Guys Cowgirl Style And Belittle Them In A Variety Of Situations! - They Show Off Their Pantyhose, And Rip A Hole In Them To Let The Guys' Cocks In! 2

  • shiiba mikuru suzuki mayu censoredschoolgirlslutOVGglory questOVG-139OVG13913ovg00139
    • 2020-05-21
    239 min

    [SW-705]A Youthful Offline Fuck With A S********l Who Loves Sex That He Met On Social Media 2

  • censoreduniformschoolgirlSWswitchswitch switchSW-705SW7051sw00705
    • 2020-05-20
    137 min

    [OVG-137]Turn You On! Panty Shots And Footjob By An Impertinent Daughter 2

  • have ai kawana censoredschoolgirlslutOVGglory questOVG-137OVG13713ovg00137
    • 2020-04-26
    132 min

    [MMUS-041]Mischevious Teasing Sisters Will Stop You From Cumming At The Last Second - Mitsuki Nagisa, Aoi Kururugi

  • scooping aoi kururugi censoredschoolgirlMMUSmarrionkijin kasaikcpMMUS-041MMUS041mmus00041
    • 2020-04-11
    196 min

    [MIRD-201]Beautiful Y********l Panty Shot Harem Hot Y********ls Love To Make Cocks Explode Akari Mitani Mitsuki Nagisa Miku Abeno

  • mitani akari scooping censoreduniformschoolgirlMIRDmoodyzdragon nishikawamoodyz realMIRD-201MIRD201mird00201
    • 2020-04-04
    164 min

    [GDHH-193]"If You Squeeze It Like That I'm Going To Cum Again!" I Fucked Her Cowgirl Style Until Cum Was Overflowing From Her Pussy!

  • censoredcreampieschoolgirlGDHHgolden timegorilla butahhh groupGDHH-193GDHH193gdhh00193
    • 2020-03-29
    160 min

    [LULU-016]A Big Ass S********l From The Literary Club Who Attends A Famous Girls' School Is Flashing Panty Shot Action At Me, And When I Could No Longer Resist, I Shoved My Big Dick In From Behind For A Quickie! This Young Lady Is Getting Her Fir

  • censoredschoolgirlamateurLULUlunaticsvagmanLULU-016LULU016lulu00016
    • 2020-03-04
    137 min

    [OVG-129]Turn You On! Panty Shots And Footjob By An Impertinent Daughter

  • scooping nanaho kase censoredschoolgirlslutOVGglory questno directorOVG-129OVG12913ovg00129
    • 2020-02-28
    239 min

    [OKAX-596]Fucking Forbidden! Testing The Options At A Secret Sexual Massage In The City! CCD Peeping 240 Min

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-596OKAX59684okax00596
    • 2020-02-01
    146 min

    [HUNTA-723]My Home Has Turned Into A Boarding House For The Girls' Volleyball Team And These Horny S********ls Are All Gathered Here Under One Roof!! My Dad Is The Volleyball Coach, And Our Home Became An Abode For All The Girls Who Came From Out

  • censoredschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-723HUNTA723hunta00723
    • 2020-02-01
    177 min

    [HUNTA-721]Inside The Foot Warmer, It Was Panty Shot Heaven! I'm Getting All The Cotton Panty Shot Action I Can Handle! Those Panties Are Bulging So Hard I Can See Their Cameltoes And That's Got My Dick Rock Hard! All Of These Little Honies C

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-721HUNTA721hunta00721
    • 2020-01-26
    126 min

    [MMUS-040]A Tempting Little Devil Gal Mio Fukada

  • mio fukada censoredschoolgirlsingle workMMUSmarrionkijin kasaikcpMMUS-040MMUS040mmus00040
    • 2020-01-16
    222 min

    [HUNTA-709]I'm Getting Knocked Out By That Tight Little Ass She's Thrusting At Me!! My Little Sister-In-Law Has A Super Beautiful Ass And A Godly Ass And I Creampie Fucked Her Over And Over Again!! I Suddenly Got A New Little Sister-In-Law, A

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-709HUNTA709hunta00709
    • 2019-12-28
    180 min

    [HUNTA-706]My Room Became A Hangout For The Girls From My Class, And Now It Was Like Panty Shot Heaven!! My Parents Are Usually Out Of The House Because They're Working, And Before I Knew It, These Classmate Girls Were Spending Their Time At My P

  • censoredcreampieschoolgirlHUNTAhuntercognac kaminohhh groupHUNTA-706HUNTA706hunta00706
    • 2019-12-10
    261 min

    [EQ-490]When My Dad Got Remarried, I Suddenly Had A New Stepmom (Big Tits), A New Little Stepsister (Tiny Tits), And Now We're Keeping It In The Family With Creampie Sex!？ They're Always Prancing Around Scantily Clad, Looking Sexy, And Flashi

  • censoredcreampiebig titsEQbullittitazuraEQ-490EQ490h-100eq00490
    • 2019-12-07
    148 min

    [MIAA-197]Tempted By My Shy-Girl Step-Daughter I Can't Hold Back When She Provokes Me By Giving Me A Full View Of Her Unprotected Panties Mizuki Yayoi

  • mizuki yayoi censoredschoolgirlbeautiful girlMIAAmoodyzgoemoneveryone s porn starMIAA-197MIAA197miaa00197
    • 2019-11-19
    135 min

    [STARS-161]For Some Reason, The Cutest Girl In School Wants To Show Me Her Panties, Tempting Me To Fuck Her - Ichika Nagano

  • ichika nagano censoredschoolgirlbeautiful girlSTARSsod createkijin kasaisod starSTARS-161STARS1611stars00161
    • 2019-11-09
    118 min

    [MIAA-185]A Cherry Boy Little Stepbrother Who Took His Big Stepsister's Provocations Seriously And Didn't Realize That She Had Already Cum And Kept On Pumping Away At Her Pussy With Out-Of-Control Fury Kanon Kanade

  • kanon kanon censoredschoolgirlbeautiful girlMIAAmoodyzhatatai ryoeveryone s porn starMIAA-185MIAA185miaa00185
    • 2019-11-08
    117 min

    [ARM-810]Uniform 25 cm Above The Knee, Panties, And A Blowjob

  • rei kitano tsukimiya koharu censoredschoolgirlblowjobARMaroma planningshigeo kadowakiaromaARM-810ARM810arm00810
    • 2019-10-27
    138 min

    [MMUS-037]The Temptation Of A Devilish Beautiful Girl Rio Kokona

  • heart vegetables rio censoredschoolgirlsingle workMMUSmarrionkijin kasaikcpMMUS-037MMUS037mmus00037
    • 2019-10-10
    186 min

    [SW-660]Every Morning, I See This Sch**lgirl Flashing Panty Shot Action At Me In Her Knee-High Socks And She Was So Cute That She Was Getting My Dick Hard And Then She Said, "You're Such A Pervert." And Then She Got Mad At Me. But Then He

  • kotone rui censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-660SW6601sw00660
    • 2019-10-03
    320 min

    [HUNTA-662]I'm Super Popular With Girls In Knee-High Socks x Miniskirt Outfits, And I'm Fucking The Shit Out Of Them Too!! I Enrolled Into A New School, Which Was An All Girls School Until Last Year, And Just Turned Coed This Year!! During Ju

  • censoredschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-662HUNTA662hunta00662
    • 2019-09-29
    134 min

    [MMUS-036]Little Devil Lust Gal Leila

  • censoredschoolgirlMMUSmarrionkijin kasaikcpMMUS-036MMUS036mmus00036
    • 2019-09-27
    174 min

    [FNEO-039]Attention All Men! Be Cautious Of Girls In The Library! "Shhhh! Be Quiet Or You'll Get In Trouble! But On The Other Hand..." Unable To Resist Her Sexy Temptation In The Library, You're On The Prowl For That Prim And Proper G

  • yuri fukada ai minano censoredcreampieschoolgirlFNEOfirst staryosukefirst star neoFNEO-039FNEO039h-491fneo00039
    • 2019-09-20
    241 min

    [DOCP-172]"I Already Came..." My Little Sister Teased Me About Me Still Being A Cherry BoyBy Flashing Her Panties At Me So I Fucked Her Wildly And Made Her Orgasm Over And Over Again! vol. 2

  • yui nagase natsuho imai censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-172DOCP172118docp00172
    • 2019-09-14
    195 min

    [HUNTA-654]"Are You Showing Me Your Panties On Purpose？" There's A High School Girl Working Part-Time At The Bakery Where I Work, And She Keeps Her School Uniform On, Making Her 130 Cute!

  • censoreduniformschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-654HUNTA654hunta00654
    • 2019-09-12
    159 min

    [SW-654]The Beauty Of A Sch**lgirl In A Ponytail, The Nape Of Her Neck, And Her Panty Shot Pleasure I Was Longingly Looking At Her As She Tied Up Her Hair, And She Was Embarrassed To Be Seen Lifting Her Armpit, And That Made My Heart Leap With Excite

  • censoredschoolgirlSWswitchlight fujimaSW-654SW6541sw00654
    • 2019-09-08
    210 min

    [MIRD-193]Lucky Punch The Academy Provocation Chiralism Harem

  • sena ai remi hayami censoredschoolgirlMIRDmoodyzkijin kasaimoodyz realMIRD-193MIRD193mird00193
    • 2019-08-16
    162 min

    [SSNI-550]This Tsundere Little Sister-In-Law Is Prancing Around Without A Care In The World, Flashing Panty Shot Temptation Every Day Mako Iga

  • iga mako censoredschoolgirlsisterSSNIs1 no 1 stylekyoseiSSNI-550SSNI550ssni00550
    • 2019-08-08
    186 min

    [SW-649]Do You Want To See My Panties？ Well Then I'll Show You! My Classmate Akari-san Always Treats Me Like A Kid. But One Day, Calling It A Special Treat, She Lifts Up Her Skirt And Shows Me Her Panties! It's The Best Day Of My Life! - Akar

  • akari neo censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-649SW6491sw00649
    • 2019-08-04
    135 min

    [DVDMS-432][Raw Fucking Sch**lgirl Selfies] She Tempted Her Friend's Big Brother With Panty Shot Action And Got Him Nice And Hard, And Then She Domesticated Him Into Her Obedient Cock So She Could Have Sex Whenever She Wanted

  • censoredcreampieschoolgirlDVDMSdeep shiromichi hoseDVDMS-432DVDMS432dvdms00432
    • 2019-07-13
    240 min

    [HUNTA-626]My Room Was So Hot, My Sister And Her Friends Decided To Get Out Of Their Clothes And Into Something Skimpier, And That Got Me Fully Rock Hard! During Summer Break, My Little Sister-In-Law Brought Her Friends Over, But Our Air Conditioner

  • censoredcreampieschoolgirlHUNTAhunterkawajirihhh groupHUNTA-626HUNTA626hunta00626
    • 2019-07-13
    206 min

    [HUNTA-627]Unguarded Panty Shot Action! Is She Doing It On Purpose？ 2 I Work Part-Time At A Convenience Store, And This Sch**lgirl Works There While Wearing Her School Uniform, And Since Her Skirt Is So Short, Whenever She Reaches Up High To Get Some

  • censoreduniformschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-627HUNTA627hunta00627
    • 2019-07-13
    156 min

    [SSNI-520]Total Domain. She'll Constantly Tempt You With Her Beautiful, Slim Thighs. The Bewitching Beauty In Knee-High Socks. Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-520SSNI520ssni00520
    • 2019-06-20
    130 min

    [NHDTB-286]Touching Her Under The Skirt Till Her Panties Get Soaking Wet! Fingering A Sensitive Woman With Just One Finger And Making Her Orgasm Over And Over Again

  • censoredschoolgirlNHDTBnatural highbacon tanakaNHDTB-286NHDTB2861nhdtb00286
    • 2019-06-06
    195 min

    [SW-636]You Like Looking Up Schoolgirl's Skirts, Don't You？ My Adorable Cousins From The Countryside Keep Trying To Seduce Me!

  • censoredSWswitchlight fujimaswitch switchSW-636SW6361sw00636
    • 2019-05-23
    100 min

    [GS-260]I Was Unexpectedly Turned On By The Sight Of This Sch**lgirl In Her Uniform, Standing At The Bookstore And Browsing In Her Short Skirt, So I Found Myself Peeping Some Panty Shot Action. But Seriously, She Didn't Catch On To Me, So I Went

  • censoredcreampieschoolgirlGSsosoru x garconikebukuro store managerGS-260GS2601gs00260
    • 2019-05-23
    215 min

    [SW-632]If You Wanna See A Schoolgirl's Panties, Give Me Money! My Cute Cousins Come To My Place Every Day And Pester Me For Money In Return For Playing With Me And Helping Me Around The House While Flashing Their Panties! They Said They'd Ne

  • censoredSWswitchlight fujimaswitch switchSW-632SW6321sw00632
    • 2019-03-28
    138 min

    [GODR-915]Naive Schoolgirl Panty Shot Festival Panty Shots Have Nothing To Do With It!! Erotic Limbo Dance Punishment Game

  • censoredschoolgirlGODRviphasshigodGODR-915GODR91578godr00915
    • 2019-03-21
    218 min

    [SW-620]The Schoolgirl I See Every Morning In Knee-High Socks Flashing Her Thighs And Panties Is So Cute, She Makes My Dick Hard. She Gets Angry And Says "You Perv" With Puffed Up Cheeks. But She Quickly Starts To Look At Me With Teary Eyes.

  • mai yahiro censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-620SW6201sw00620
    • 2019-03-20
    99 min

    [ARM-746]Don't Look At My Panties! She Fights Back With More Embarrassment! The Schoolgirl "Leg Scissors" My Face With Her Thighs

  • hinano kanzaka miharu kawada anri mita censoreduniformschoolgirlARMaroma planningaromaARM-746ARM746arm00746
    • 2019-03-16
    170 min

    [HUNTA-566]A Lucky Sexual Incident Involving My Younger Stepsister And Her Friends During A Pajama Party!! Our Parents Remarried And Now I Have A Cute Stepsister. When Our Parents Went Away On Holiday, She Invited Her Friends Over For A Sleepover! Th

  • censoredschoolgirlsisterHUNTAhunterkoichi davidsonhhh groupHUNTA-566HUNTA566hunta00566



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download