jav censored def creampie bitch




FC2BBANHZGDMIAAROYDPPPDGVHJUFEATIDSPRDSTARSADNFSDSSMILKMEYDMVSDMARACJODSANCAWDNACR

2020-10-08
124 min

[FSDSS-103]Nipple Play, Defenseless Temptation - Sakura Tsukino

  • tsukino sakura censoredsingle workFSDSSfalenotomonori maedafaleno starFSDSS-103FSDSS1031fsdss00103
    • 2020-10-08
    161 min

    [SW-732]I Was Hospitalized And All The Nurses Have Big Tits And Don't Wear Bras!？ I Was Jacking Off While Peeping At Their Peekaboo Titties And Suddenly, To My Surprise, All My Dreams Were About To Cum True!？

  • censoredbig titsnurseSWswitchcambridgeswitch switchSW-732SW7321sw00732
    • 2020-10-08
    147 min

    [EKDV-645]Oily Body - Ayase Tsuyunashi

  • ayase russian pear censoredcreampiebig titsEKDVcrystal eizokumataro morinoe kissEKDV-645EKDV64549ekdv00645
    • 2020-10-17
    120 min

    [OKSN-307]Stepfamily Threesome - Creampie Sex

  • censoredcreampieOKSNabc mousouzokuokasan.comOKSN-307OKSN307oksn00307
    • 2020-10-22
    93 min

    [OKS-098]Wet And Shiny, Perfectly Fitting Godlike Swim Suit: Horikita Tsumugi. Enjoy These Cute S*********ls' Swimsuits! This AV Starts With A Voyeur View Into A Changing Rom, And Ends With Close-ups Of Fetishes Such as Shaved Pussies, Hair Stick

  • horikita tsumugi censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-098OKS0981oks00098
    • 2020-10-28
    66 min

    FC2PPV 1548963 First shot ❤️ Beautiful breasts ❤️ Slender sensitive body ❤️ I have 3P rolled up with an anime voice ~

  • amateur uncensoredfc2
    • 2020-11-06
    115 min

    [PARATHD-3044]She Agreed To Be Filmed So Long As Masks Are Involved - Ordinary College Girl Mei, 20 Years Old

  • censoredamateurPARATHDparadise tvPARATHD-3044PARATHD3044parathd03044
    • 2020-11-12
    123 min

    [FGAN-028]An Unexpected Erection A Beautiful Girl Bares Her Panties Mako Mako Shion

  • miko shion censoredcosplaysingle workFGANfetish eyesFGAN-028FGAN028h-1440fgan00028
    • 2020-11-13
    90 min

    [SS-007]Only You - Kana Morisawa

  • matsushita hikari uehara hanakoi censoredcreampiebig titsSSplumSS-007SS00713ss00007
    • 2020-11-21
    49 min

    FC2PPV 1577862 [A lot of benefits] If you try to have a junior who was a virgin until a while ago and a locally famous gal bitch alone … You will have sex insanely (laugh)

  • amateur uncensoredfc2
    • 2020-11-25
    86 min

    435MFC-057 Kikko-san (26)

  • amateur censoredcreampiebig titsmfcmfc-057mfc057435mfc-057
    • 2020-11-27
    476 min

    [HRV-050]Super Sexy!! Slick And Slippery Lotion-Lathered & Oiled-Up Sex 30 Ladies Best Hits Collection 8 Hours

  • censoredHRVprestigeharvestHRV-050HRV050118hrv00050
    • 2020-12-15
    44 min

    FC2PPV 1607466 [Appearance / Uncensored / Affair NTR] From one affair to an affair … Fcup beautiful wife’s rich service and conceived at the woman on top posture NTR! I do not show it to my husband, but the lascivious waist usage and blowjo

  • amateur uncensoredfc2
    • 2020-12-23
    72 min

    FC2PPV 1617059 It will end soon [Uncensored] Miss 〇 University talent, confidential and private continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2020-12-31
    152 min

    [PRED-279]Sensitive Nipples, Slender Body, Trembling Orgasms. Sorry I'm Cumming So Hard, It's My First Time - 4 Full Fucks Mami Sakurai

  • mami sakurai censoredsquirtingblowjobPREDpremiummichiru arashiyamaelegancePRED-279PRED279pred00279
    • 2021-01-13
    134 min

    496SKIV-001 Yuki who loves cum swallowing 2nd year of real estate business [Part 1]

  • amateur censoredamateurskivskiv-001skiv001496skiv-001
    • 2021-01-21
    169 min

    [NHDTB-483]Perverted Private Tutor Anal Fucks A S*****t To Encourage Her To Improve Her Grades 2

  • censoreduniformNHDTBnatural highlemonheart nakajimaNHDTB-483NHDTB4831nhdtb00483
    • 2021-01-22
    54 min

    [oretd-834]ゆいちゃん 3

  • amateur censoredcreampieuniformoretdoretd-834oretd834oretd-834
    • 2021-01-23
    21 min

    H0930 ki210123 piddle 20years old

  • amateur uncensoredh0930
    • 2021-01-24
    111 min

    [AGMX-070]Nipple-Licking Sixty-Nine

  • yuki s shiina noa censoredslutAGMXsex agent daydreamersdaibutsu yoshidasex agentAGMX-070AGMX070agmx00070
    • 2021-02-18
    70 min

    [SIROR-050]Rent-A-MILF - The Hidden Side Of Mature Wives Their Husbands Never See File. No. 50 -

  • censoredcreampiebig titsSIRORdispatched.comSIROR-050SIROR050h-1492siror00050
    • 2021-02-25
    93 min

    [OKS-106]Wet And Shiny, Perfectly Fitting Godly Swimsuit: Minano Sena Is Enjoying Her Cute Girls' School Swimsuit! This AV Starts With A Voyeur Video Of Big And Small Breasts And Moves On To A Number Of Fetish CLose-ups, Such As Shaved Pussies, H

  • minano sena censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-106OKS1061oks00106
    • 2021-02-25
    128 min

    [MOND-210]With My Female Boss Who I Adore - Yuuka Hirose

  • yuka hirose censoredmature womansingle workMONDtakara eizohotate ikkandaiichi housouMOND-210MOND21018mond00210
    • 2021-03-13
    121 min

    [MUDR-143]My Little Stepsister Is A Cute GAL Real Edition My Little Stepsister Wants To Cuddle. Momo Kato ka

  • kato momoka censoredcreampiesquirtingMUDRmukuMUDR-143MUDR143mudr00143
    • 2021-03-15
    109 min

    YAHO-001 Marnie

  • amateur censoredcreampiebig titsyahoyaho-001yaho001yaho-001
    • 2021-03-16
    70 min

    [CRNX-017]I Want To Lose My Virginity To My Step Sister! Angelic Step Sister Agrees To Become A Sex Practice Partner With Her Virgin Step Brother Who Got His First Ever Girlfriend

  • momose asuka censoredcreampieuniformCRNXcrystal pictureharuo miyafujicrystal nextCRNX-017CRNX01749crnx00017
    • 2021-03-26
    127 min

    [JUFE-272]My Horrible Step Father Seduces And Licks Me Whenever My Mom Isn't Looking... Mahiro Ichiki

  • mahiro ichiki censoredschoolgirldeepthroatJUFEfitchJUFE-272JUFE272jufe00272
    • 2021-04-02
    119 min

    [JUL-534]永遠に終わらない、中出し輪●の日々。 鈴乃広香

  • hiroka suzuno censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-534JUL534jul00534
    • 2021-04-15
    130 min

    [JRZE-041]First Time Filming My Affair: Aya Kasuga

  • kasuga aya censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-041JRZE041h-086jrze00041
    • 2021-04-16
    59 min

    [tkwa-168]あゆみ＆るい

  • amateur censoredcreampieschoolgirltkwatkwa-168tkwa168tkwa-168
    • 2021-04-17
    120 min

    [JUL-540]Rare Gem - Mrs Diamond Exclusives Part 4! Her First Adultery! "I'm Off To My Class Reunion," She Says, And Three Hours Later She's Already Fucked. Hitomi Honda

  • honda hitomi censoredmature womansingle workJULmadonnaJUL-540JUL540jul00540
    • 2021-04-20
    130 min

    [STARS-362]This Dirty Old Man Is An Absolute Impregnator And When He Grinds His Big Dick Against Her Cunt She'll Cum With Pleasure She's Lifting Her Creampie Ban For The First Time And Getting 10 Cum Shots! A Semen-Slathered Impregnation Fuck

  • nogi firefly censoredbig titsuniformSTARSsod createkomatsu 17sod starSTARS-362STARS3621stars00362
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    162 min

    [SSIS-060]Mixed Body Fluids, Hot And Steamy Sex Complete Unedited Special Kozue Fujita

  • kozue fujita censoredsquirtingsingle workSSISs1 no 1 stylemon cSSIS-060SSIS060ssis00060
    • 2021-05-02
    135 min

    [URKK-039]You'll Cum At Least 10 Times! Big Titty Aphrodisiac Massage Where The Girls Cum And Shake Their Huge Tits While They Let You Fill Them With As Many Loads As You Want Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsURKKunfinishedwild sevena familiar breastURKK-039URKK039urkk00039
    • 2021-05-14
    58 min

    SIRO-4509 [First shot] [Fighting wife of immorality] [F cup of pink nipples] An immoral married woman who is very excited about a big cock. Sensitive body reacts indecently, and the appearance of sucking another stick deliciously .. AV application on

  • amateur censoredbig titsmarried womansirosiro-4509siro4509siro-4509
    • 2021-05-16
    16 min

    10musume 051621_01 Wanna see Prego’s masturbation？ Hiroko Ookubo

  • amateur uncensored10musume
    • 2021-05-29
    160 min

    [LULU-071]When He Could No Longer Resist The Temptation Of His Step Auntie's (A Former Bad Girl) Big Ass, He Transformed Into A Horny Sexual Monkey! He Grabbed Her Hips As He Pumped Her From Behind Until He Creampie Ejaculated His Entire Load Int

  • kiyoshi maihara censoredcreampiesingle workLULUlunaticsvagmanLULU-071LULU071lulu00071
    • 2021-06-19
    74 min

    418YSS-82 Sakura

  • amateur censoredbig titsamateuryssyss-82yss82418yss-82
    • 2021-06-21
    68 min

    SIRO-4519 AV application on the net → AV experience shooting 1568 [First shot] [THE sex symbol] [Big breasts x big butt x big iki] Arasa beauty who is about to get married makes memories secretly to her boyfriend. Shake the soft milk of the I cup in

  • amateur censoredbig titsamateursirosiro-4519siro4519siro-4519
    • 2021-06-27
    59 min

    200GANA-2512 Seriously Nampa, first shot. 1654 Picking Up A Kind And Nice Blonde White Gal! Excited and desperate for a bristle lewd gap that does not look good on the face! Sensitive Oma ● Ko repeats medium alive many times …

  • amateur censoredamateurganagana-2512gana2512200gana-2512
    • 2021-07-08
    57 min

    FC2PPV 1911550 Until the 15th [Appearance] Cum swallowing on that child’s bristle pussy that can be understood by those who understand

  • amateur uncensoredfc2
    • 2021-08-14
    114 min

    [AARM-009]Nipple Sucking ASMR

  • mihina azumihina mihina nagai nozomi nozomi censoredslutAARMaroma kikakukadowaki shigeoaromaAARM-009AARM009aarm00009
    • 2021-08-24
    115 min

    460SPCY-021 [20 Years Old Kanagawa Prefecture] Yui

  • amateur censoredcreampiebig titsspcyspcy-021spcy021460spcy-021
    • 2021-09-10
    151 min

    [SSIS-172]J-Cup Older Stepsister Right Next To My Girlfriend. Secret Dirty Talk And Extreme Nipple Play. Rara Anzai

  • anzai rara censoredbig titsslutSSISs1 no 1 stylegoemonSSIS-172SSIS172ssis00172
    • 2021-09-17
    120 min

    [PRED-340]My Senior Riona Who Is Famous For Her Beauty Became My Personal Cock Sucker And It Is A Secret Between The Both Of Us Riona Hirose

  • rio hirose censoredblowjobslutPREDpremiumakai suiseielegancePRED-340PRED340pred00340
    • 2021-09-20
    89 min

    [MOKO-037]I Tried To Kiss My Older Landlady...

  • censoredblowjobmature womanMOKOstar paradisetotsu dou mokkori douMOKO-037MOKO037h-254moko00037
    • 2021-10-02
    130 min

    [PKPR-003]A Day Of Fucking In A One Room Apartment With Industry Ace Aoi Kururugi

  • aoi kururugi censoredcreampiebeautiful girlPKPRpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPR-003PKPR003pkpr00003



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download