jav censored cowgirl creampie javcensored




FC2CESDHMNCAWDKBIADNDASDAUKGAUKSSPRDVEMASHKDMIAAAWDHNDWAAASDABATIDLULUHODVMARA

2020-12-07
41 min

[ore-729]レナ 2

  • amateur censoredcreampieamateuroreore-729ore729ore-729
    • 2021-01-01
    101 min

    FC2PPV 1628306 * Half price for a limited time until 1/4 4980pt → 2490pt [No] 4 past works of cute junior college students! + Bonus video * New sample video with review benefits

  • amateur uncensoredfc2
    • 2021-01-02
    122 min

    [UMD-762]Undercover! The Lymph Massage Parlor Everybody's Talking About 5 "How About Our Secret Options？"

  • kimishima mio natsu tojo censoredblowjobhandjobUMDleodragon nishikawaUMD-762UMD762125umd00762
    • 2021-01-06
    64 min

    [sika-013]あーちゃん(18)

  • amateur censoredcreampiebig titssikasika-013sika013sika-013
    • 2021-01-09
    65 min

    SIRO-4345 [First shot] [Screaming baby-faced girl] [Powerful nice ass cowgirl] A pure female college student who still has the innocence of a girl. If you advance to the extent that the developing beauty man is about to break, the girl will panting w

  • amateur censoredamateursirosiro-4345siro4345siro-4345
    • 2021-01-22
    244 min

    [MFCC-007]MOON F***e CHEERS Sucking Collection. vol. 7

  • censoredcreampiebig titsMFCCprestigemoon force cheersMFCC-007MFCC007118mfcc00007
    • 2021-01-23
    53 min

    H0930 ki210124 Michiko Akashi 33years old

  • amateur uncensoredh0930
    • 2021-01-24
    135 min

    [DBER-096]The Lusty Beast Hunting Club Anal Sex Goes Viral - An Alluringly Beautiful Girl Cums To Hell - Part 7: This Sheltered Young Lady Got Anal Fucked And She Spasmed In Shame Until She Came In Ecstasy Mirei Nitta

  • mirei nitta censoredanalschoolgirlDBERbabyentertainmentkikubonred babeDBER-096DBER096dber00096
    • 2021-01-29
    72 min

    [MBRBM-013]SEX - Mai Fukuhara

  • mai fukuhara censoredbig titssingle workMBRBMspice visualMBRBM-013MBRBM0135141mbrbm00013
    • 2021-02-21
    119 min

    [CAWD-177](A Teacher Must Never Commit Herself To Pure Love) She Couldn't Ignore The Needs Of Her Male S*****t, And When He Tickled Her Maternal Instinct, One Night, During A Typhoon, They Hungrily Feasted Upon Each Other Until They Destroyed Eve

  • maiyuki ito censoredcreampiesingle workCAWDkawaiisuisei akaiCAWD-177CAWD177cawd00177
    • 2021-02-26
    51 min

    [CLO-128]Tiny Titty Nipples A Tiny Barely Legal Babe And Her Shameful Nipples Ayu Sumikawa

  • sumikawa pa censoredsquirtingblowjobCLOchobitchchovicCLO-128CLO128h-1435clo00128
    • 2021-03-01
    79 min

    259LUXU-1378 Luxury TV 1372 “I’m tired of ordinary sex … I want to experience more exciting fellowship.” Contrary to the atmosphere of a cute lady, an honest pianist appears in pleasure! When I witnessed the actor, I naturally smi

  • amateur censoredamateurluxuluxu-1378luxu1378259luxu-1378
    • 2021-03-03
    73 min

    326EVA-144 Drink a guarantee at the pool pick-up immediately Paco ☆ If you switch on, you will not know the ceiling! Suppress Mutsurisukebe, who is weak to push, with the power of gold ww

  • amateur censoredamateurevaeva-144eva144326eva-144
    • 2021-03-05
    303 min

    [HEZ-257]Female Office Workers, Coworkers And Working Women! 300 Minutes For Everyone Who Gets Hard For Female Office Workers 20 Minutes

  • censoredcreampieuniformHEZhot entertainmenthotHEZ-257HEZ25759hez00257
    • 2021-03-05
    121 min

    [TUE-110]複数の男たちに犯●れ続けるロ●ータ美少女映像集

  • censoredcreampiebeautiful girlTUEglayzteito ura eizouTUE-110TUE11012tue00110
    • 2021-03-10
    120 min

    459TEN-014 [Gachi Sex Beast] Assault on the home of an F milk gal who likes and likes Ji ◯ Ko and has gone crazy because he likes it too much! !! Bombshell fuck with a special game underwear for gals! !! Cum shot sex that does not end with 3 sexual a

  • amateur censoredcreampiebig titstenten-014ten014459ten-014
    • 2021-03-18
    29 min

    FC2PPV 1731817 Super god style !! The boxed lady is interested and the first Gonzo in her life 2 shots ♡ Good personality and good style

  • amateur uncensoredfc2
    • 2021-03-19
    60 min

    [sika-051]まどかちゃん(18)

  • amateur censoredcreampiesquirtingsikasika-051sika051sika-051
    • 2021-03-26
    240 min

    [OKAX-723]She's Spreading Her Tight Young Pussy Wide And Begging For Cock! A Beautiful Girl Pussy Temptation Collection

  • yukari miyazawa swan tin censoredbeautiful girlslutOKAXk m produceokazuOKAX-723OKAX72384okax00723
    • 2021-04-02
    100 min

    [BF-629]The Girl Next Door Is A Horny Slut Who Is Luring Me To Temptation Creampie Cowgirl Semen-Sucking Sex Riho Fujimori

  • riho fujimori censoredcreampiesquirtingBFbefreeBF-629BF629bf00629
    • 2021-04-03
    139 min

    [DNJR-047]Youthful Foot Academy Going Crazy From Feet That Smell Like The Ripe Sour Scent Of Youth

  • riko sato otohana eve censoredslutDNJRdog daydreamersmaboroshikoDNJR-047DNJR047dnjr00047
    • 2021-04-03
    104 min

    FC2PPV 1752327 Celebration! The 4th thank-you project for a cumulative total of over 20,000! [No individual shooting, outflow, young lady Gachi Beautiful girl NO. Who was sold by the dark route without being asked anything. 3] I’ll just say that

  • amateur uncensoredfc2
    • 2021-04-09
    123 min

    [KAM-081]I Brought The Married Woman Part-Timer Home From A Work Party, And Took Hidden Camera Voyeur Footage Of Our Fucks, Then Secretly Sold It As Porn

  • censoredcreampiebig titsKAMkarmamanji groupKAM-081KAM081kam00081
    • 2021-04-15
    59 min

    413INST-113 Kansai Dialect Big Breasts Gal Keito-chan 18 Years Old ☆ F-Cup Covered With Adorable Lotion That Spree Lightly Just Rubbing ♪ Sensitivity 100x x Endless Piston "Forgive me Because You Can Put It Inside!"

  • amateur censoredcreampiebig titsinstinst-113inst113413inst-113
    • 2021-04-18
    126 min

    [AGAV-053]Nympho Step Sisters # 2 ~ Big Titty College Girl Step Sisters Share Dick For Fun ~

  • miki sanada miki sanada mizuki sanada mai takeda censoredbig titsbeautiful girlAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-053AGAV053agav00053
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-07
    120 min

    [EBOD-820]Momo Nanase Finally Allowing Herself To Be Cum In! Teasing And Playing With Her Pink Nipples Before Giving Her A Creampie! Nipple Play Impregnation 3 Cum Shots

  • nanase momo censoredcreampiebig titsEBODe bodytrendy yamaguchiEBOD-820EBOD820ebod00820
    • 2021-05-18
    62 min

    499NDH-018 The reality of an elegant married woman is a super carnivorous Yarimoku married woman who catches a man with a matching app! ？？ Congratulations and graduation from virginity spoiled by a perfect slender G cup that does not seem to be a ful

  • amateur censoredcreampiebig titsndhndh-018ndh018499ndh-018
    • 2021-05-29
    120 min

    [RPIN-051]Usually She Never Wants To Do Anything ... A Beautiful Apparel Shop Girl She Was Transformed Into A Horny Bitch Thanks To His Hot Horny Cock And Now She's Cumming Like A Queen!

  • censoredRPINlycopene mousouzokuRPIN-051RPIN051rpin00051
    • 2021-06-05
    240 min

    [MLSM-046]S-class Beautiful Mature Woman Best Hibiki Otsuki 4 Hours, Slender Madonna With Beautiful Tits

  • otsuki sound censoredcreampiemarried womanMLSMmellow moonMLSM-046MLSM046mlsm00046
    • 2021-06-08
    140 min

    [MSFH-061]Hot Babe So Desperate For Your Seed She Spreads Her Own Pussy Wide For Your Creampie Konomi Yoshinaga

  • konomi yoshinaga censoredcreampiesingle workMSFHsod createzaku araims sodMSFH-061MSFH0611msfh00061
    • 2021-06-17
    101 min

    [VENX-049]I Can't Wait For Summer! Step Family Love Bikini Stepmom Nene Tanaka

  • nene tanaka censoredcreampiebig titsVENXvenusmajime kitanofakecest winntersVENX-049VENX049venx00049
    • 2021-07-02
    38 min

    520SSK-014 Mio

  • amateur censoredcreampieamateursskssk-014ssk014520ssk-014
    • 2021-07-17
    120 min

    [JUL-661]"I'm Serious, You Only Get To Stick In The First 3cm, Okay ...？" When I Met My C***dhood Friend For The First Time In Years, We Started Messing Around From The Get Go, And We Spent A Week Becoming More Than Friends, But Not Quite

  • shinoda yu censoredcreampiebig titsJULmadonnarokusaburo mishimaJUL-661JUL661jul00661
    • 2021-07-18
    243 min

    [NANX-232]A Pretty & Horny Woman Picks Up Innocent-Looking Amateur Girl On The Street For Some Lesbian Action 3

  • nozomi haneda ayako inoue censoredlesbianNANXnanpa heavenjun nagasawaNANX-232NANX232nanx00232
    • 2021-07-22
    172 min

    [JUFE-315]Bondage Suite Room Two Gorgeous Sluts Ravish Men And Drive Them Crazy Toka Rinne Yuria Satomi

  • roaring sound satomi yuria censoredbig titsslutJUFEfitchaida yumenoJUFE-315JUFE315jufe00315
    • 2021-07-31
    125 min

    [DNJR-055]"I Support Your Coming!" A Home-Delivery Supporter of Jacking Off. Mizuki Yayoi.

  • mizuki yayoi censoredbig titsslutDNJRinu mousozokumaboroshi koDNJR-055DNJR055dnjr00055
    • 2021-08-03
    190 min

    [STARS-398]Masochist Awakening. "Tease Me, Hard" MINAMO Ultra Large Newbie, Digital Exclusive Gift + Fuck Record Filmed At Debut!

  • minamo censoredbig titssoloworkSTARSsod createeasy matsumotosod starSTARS-398STARS398
    • 2021-08-31
    183 min

    [SDNM-299]People Think I Can Do Anything But There Are Times Where I Just Want To Be Spoiled Airi Suenaga, 29, AV DEBUT

  • suenaga airi censoredmarried womansoloworkSDNMsod createcompany matsmahonmono hitodzuma dannani naisho de av taikenSDNM-299SDNM299
    • 2021-08-31
    52 min

    10musume 083121_01 Hooked up with the Shopaholic College Student Nao Kojima

  • amateur uncensored10musume
    • 2021-09-10
    118 min

    [BBAN-340]Asuka And Chiharu As Long As I Have You, I Don"t Need Anything Else ... Asuka Momose Chiharu Sakurai

  • momose asuka chiharu sakurai censoredlesbiancosplayBBANbibianBBAN-340BBAN340bban00340
    • 2021-09-25
    150 min

    [SCPX-433]Voyeur Video: Married Women Naked And Filmed At The Chiropractor *Incredible Orgasms!*

  • censoredcreampieSCPXk m producehasshiscoop kmpSCPX-433SCPX433scpx00433
    • 2021-09-30
    47 min

    H4610 ki210930 Ayumi Chiba 25years old

  • amateur uncensoredh4610
    • 2021-10-01
    117 min

    [MIAA-506]I Couldn"t Help Myself After My Provocative Stepsister Kept Showing Me Glimpses Of Her Panties, Starring Hana Shirato

  • white peach censoredcreampiebeautiful girlMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-506MIAA506miaa00506
    • 2021-10-04
    60 min

    541AKYB-001 Nene (19) 147cm Minimum Beautiful Girl ♪ (Fuyu Ai Kotone)

  • amateur censoredcreampieamateurakybakyb-001akyb001541akyb-001
    • 2021-10-04
    70 min

    328HMDN-413 [Piano Lecturer] Keiko Married Woman 39 Years Old A Neat Wife Climaxes With Delight At The Cock For The First Time In 5 Years. Sex Pickled Creampie Gonzo [Personal Shooting] (Yumi Sakurai)

  • amateur censoredcreampiemarried womanhmdnhmdn-413hmdn413328hmdn-413
    • 2021-10-08
    170 min

    [IPX-734]Flirtatious Lovestruck Couple Experience: Soothing Deep Kisses, Naughty Techniques, And Endless Sex! Starring Mai Kanami

  • kanna mimai censoredblowjobsingle workIPXidea pocketkyouseitissueIPX-734IPX734ipx00734
    • 2021-11-03
    27 min

    FC2PPV 2401111 Until Today! Appearance! "# 2-2" An Innocent 18-Year-Old Girl Who Came To Tokyo. Creampie, Cum Swallowing And Dirtying Two Holes ♡ Both Feelings ♡

  • amateur uncensoredfc2



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download