jav best omnibus javcensored hours more incest




FC2NACRVENXMIDVSQTEROYDGMEMSSISMVSDSSNIWAAAPREDAWDAUKGCAWDAUKGMEYDMIDEHDKAGVHCESD

2020-11-12
240 min

[KNMB-006]Complete Raw Style @ Ms. Nakata Amateur Video Halo 5 Girls 240 Min. #S-Class Beauty Kanon #Sweaty Masochist Mirina #Slender Black Pantyhose Remu #A-Cup Pussy Juice Yui #Minimalist Husky Voice Kanon

  • kanon kanon minami kosaka censoredcreampieschoolgirlKNMBfirst star100 raw styleKNMB-006KNMB006h-491knmb00006
    • 2020-11-26
    142 min

    [NTRD-084]Cuckolders I'm Glad I Seduced Her, Your Wife Is A Fine Piece Of Ass... Hana Haruna

  • haruna hana censoredmature womansingle workNTRDtakara eizokouji takarashintokaiNTRD-084NTRD08418ntrd00084
    • 2020-12-03
    17 min

    HEYZO 2407 Riko’s Amazing Footjob – Riko Hidaka

  • riko hidaka uncensoredheyzo
    • 2020-12-04
    48 min

    [oretd-812]永澤さん

  • amateur censoredcreampieuniformoretdoretd-812oretd812oretd-812
    • 2020-12-08
    120 min

    [STARS-296]I Want A Pure And Innocent L*lita To Fuck Me Like A Slut Ichika Nagano

  • ichika nagano censoredcosplaybeautiful girlSTARSsod createsamoarisod starSTARS-296STARS2961stars00296
    • 2020-12-10
    121 min

    [FSDSS-136]My Girlfriend's Little Sister Is An Excessively Sensual Premature Ejaculator Who Will Lure You To Time-Saving Temptation In High-Class Lingerie Sora Shiina

  • shiina sky censoredbeautiful girllingerieFSDSSfalenogoemonfaleno starFSDSS-136FSDSS1361fsdss00136
    • 2020-12-12
    119 min

    [MEYD-643]The Horny MILF At My Part-Time Job Is My Very Own Personal Cum Dumpster Ayaka Mochizuki

  • ayaka mochizuki censoredcreampiesquirtingMEYDtameike goroMEYD-643MEYD643meyd00643
    • 2020-12-18
    127 min

    [NCYF-008]Real 6-Some Orgy! The Most Pouty, Prickly Cosplayer With A Secret Soft Side This Club Has Ever Seen "Please, I Want It Deeper" - Screaming Orgasms, Endless Sex (10 Squirting, Furious Orgasms) (Every Guy There Breeds Her With His Cum

  • censoredcreampiesquirtingNCYFall japan kameko cooperative delusional groupudagawaall japan kameko cooperative mousouzokuNCYF-008NCYF008ncyf00008
    • 2020-12-18
    56 min

    444KING-021 Yuria-san

  • amateur censoredcreampiemarried womankingking-021king021444king-021
    • 2020-12-29
    136 min

    [KIRE-016]"During The Meeting, During Our Sales Negotiations, All I Could Think About Was Sex" This Pretty Office Lady Is Baring Her Lust At The Office And Luring Us To Temptation-Filled Sex Sumire Kurusu

  • sumire kurusu censoredblowjobslutKIREsod createmid eyebeauty kirei sodKIRE-016KIRE0161kire00016
    • 2021-01-09
    119 min

    [IPX-600]French Kisses That'll Make You Lose Your Mind - Devilish Little Slut Seduces Older Guys Yume Nishimiya

  • yume nishinomiya censoredcreampieschoolgirlIPXidea pocketdishIPX-600IPX600ipx00600
    • 2021-01-09
    115 min

    [DASD-794]CLose Up. Shemale Squeen Mayumi Harukaze

  • spring wind mayumi censoredsingle workDASDdashajime yanaiDASD-794DASD794dasd00794
    • 2021-01-10
    63 min

    FC2PPV 1639226 Limited to 300 [Uncensored] Continuous vaginal cum shot to the older sister at the company reception

  • amateur uncensoredfc2
    • 2021-01-12
    91 min

    [EMOI-038]2 Consecutive First-Time Creampie Fucks During A Threesome Fuck Fest (She's Lifted Her Ban) A Date In Shonan A Real-Life W University S*****t She Looks Good In Short Hair Mao Watanabe (20)

  • mao watanabe censoredcreampieEMOIsod createtanaka baconemo girlEMOI-038EMOI0381emoi00038
    • 2021-01-15
    212 min

    [SKMJ-142]Real Pickup! Nursery School Teacher Overflowing With Maternal Affection Lavishes You With A Motherly Blowjob! And A Handjob Using Her Cleavage! "Honestly, Most Nursery School Teachers Are Sluts..." After You Cum Once She Wants Your

  • censoredcreampiebig titsSKMJblush girlkikufukuSKMJ-142SKMJ142h-1324skmj00142
    • 2021-01-18
    65 min

    SIRO-4339 [First shot] [Ultra-naive x fair-skinned body] [Unimaginable humorous face] An ultra-naive naive girl feels like she’s throwing lewd juice. To her who is ashamed to hide her face .. AV application on the net → AV experience shooting 14

  • amateur censoredsquirtingamateursirosiro-4339siro4339siro-4339
    • 2021-01-22
    115 min

    [PARATHD-3090]Mature Lady Youtuber Makes A Video Live On Stream In Get-Rich-Quick Scheme: Complete Edition

  • tamaki mai amie tokoshi censoredblowjobmature womanPARATHDparadise tvPARATHD-3090PARATHD3090parathd03090
    • 2021-01-24
    141 min

    [QRDA-122]Beautiful Legs - Long-Legged Mistress Teases You Sara

  • censoredQRDAqueen roadQRDA-122QRDA122qrda00122
    • 2021-02-01
    58 min

    DIZ-013 Asami

  • amateur censoredcreampiebig titsdizdiz-013diz013diz-013
    • 2021-02-05
    100 min

    [SCR-263]Following A Married Woman And Creampie Fucking Her

  • censoredcreampiedeepthroatSCRglay zs crimeSCR-263SCR26312scr00263
    • 2021-02-05
    63 min

    [YMDS-017]First Time Amateur Shots Documental: Can't Let An Amateur Of The Highest Class Get Away (Miu, 25)

  • censoredcreampieamateurYMDSmomotaro video publishingasakusa is jiroyoung peachYMDS-017YMDS017ymds00017
    • 2021-02-05
    53 min

    417SRYA-001 [Erotic ass x 2 beautiful women] I haven’t heard that the instructor teacher is so naughty (sweat)! !! Look at the sexy ass! Rubbing! Be sandwiched! At the end, insert raw cheeks into 2 beautiful women … Thanks to you, I am stil

  • amateur censoredcreampiebig titssryasrya-001srya001417srya-001
    • 2021-02-12
    109 min

    [GGEN-010](Real Sexy Escapes - Spin Off) If You Don't Have Anal Sex, The Door Won't Open...

  • nanako takamiya mihina azumihina mihina nagai censoredGGENprestige3 jigen mimanGGEN-010GGEN010118ggen00010
    • 2021-02-12
    141 min

    [BNST-025]Barely Legal Eros Mahiro Ichiki

  • mahiro ichiki censoredcreampiebeautiful girlBNSTteacher delusion groupthere is alsoBNST-025BNST025bnst00025
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-12
    115 min

    [FTUJ-002]A Tall Female College S*****t Who Accepted To Do A Naughty Shoot On The Condition That She Could Wear A Mask - Kaoru-chan, 22 Years Old

  • censoredamateurFTUJordinary girlsFTUJ-002FTUJ002h-1573ftuj00002
    • 2021-03-25
    189 min

    [NHDTB-506]Young Wife Slipped An Anal Aphrodisiac During Her Pre-Marital Check-Up Starts Gushing Pussy Juice

  • censoredanalcreampieNHDTBnatural highlemonheart nakajimaNHDTB-506NHDTB5061nhdtb00506
    • 2021-04-01
    120 min

    [NACR-409]Real Sex Stories From Two Slutty Girls Hibiki Otsuki Yui Hatano

  • otsuki sound yui hatano censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-409NACR409h-237nacr00409
    • 2021-04-17
    238 min

    [NPJB-055]They Get Wet After A Little Liquor - Drenched Pussies, Smiling Faces, Tipsy Sex - 4 Happy Hours

  • censoredbig titsbeautiful girlNPJBnanpa japanNPJB-055NPJB055npjb00055
    • 2021-05-02
    242 min

    [MMB-364]Shinbashi Sluts - 10 Sugar Babies Seeking Dates - Already Bored Of Their New Jobs, They Want A Little Excitement Over Their Vacations! Special - Me, Their Boss, Will Show You How To Score With Them

  • censoredamateurbeautiful girlMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-364MMB364mmb00364
    • 2021-05-14
    120 min

    [OKSN-334]A New Discovery! This Neat And Clean Beauty Is A Maso Bitch Who Gets Tied Up And Will Lick Men's Feet And Toes While Her Panties Become Dripping Wet As Her Body Twitches And Trembles With Filthy, Rich And Orgasmic Ecstasy

  • censoredblowjobOKSNabc mousouzokuokasan.comOKSN-334OKSN334oksn00334
    • 2021-05-18
    69 min

    FC2PPV 1824141 [Limited video] TwitCasting huge breasts K ③ Rhythmic gymnastics club completely fell into an unequaled penis, too young erotic soft body & Gonzo outflow that spree acme while squeezing a huge breasts pussy personal shooting

  • amateur uncensoredfc2
    • 2021-05-23
    169 min

    240TOKYO-427 Urara

  • amateur censoredamateurbeautiful girltokyotokyo-427tokyo427240tokyo-427
    • 2021-06-11
    65 min

    FC2PPV 1862948 [Leaked] Big breasts II cup gravure idol individual photo session Hotel video leaked From idol Gonzo with secret individual shooting Creampie [Top secret data attached with set purchase]

  • amateur uncensoredfc2
    • 2021-06-20
    99 min

    [KIR-036]Beautiful Snack Mama Shuri Yamaguchi

  • yuri yamaguchi censoredcreampiemature womanKIRstar paradisekirei star paradiseKIR-036KIR036h-254kir00036
    • 2021-07-01
    37 min

    FC2PPV 1898023 [No] [Appearance] [Review benefits] Gonzo the president’s secretary REN for the first time in a year ♡ Vacuum blowjob and seeding press!

  • amateur uncensoredfc2
    • 2021-07-02
    147 min

    [SSIS-109]This Father-In-Law Lives Alone And Is Pretending To Be Senile, But The Truth Is That He's A Horny Sexual Monster Who Is Disguised As A Harmless Old Man. Tsubaki Sannomiya

  • sannomiya tsubaki censoredbig titssingle workSSISs1 no 1 styleamazing meatSSIS-109SSIS109ssis00109
    • 2021-07-06
    56 min

    188HINT-0465 Yuna

  • amateur censoredcreampiemarried womanhinthint-0465hint0465188hint-0465
    • 2021-07-14
    175 min

    [DVDMS-689]Kiu Aihara Finally Ready For Creampie Sex - 3 Full Fucks, 8 Loads - 18-Year-Old College Girl's First Experiences With Raw Sex

  • aihara tsukiha censoredcreampiebeautiful girlDVDMSdeep sfunky hasegawaDVDMS-689DVDMS689dvdms00689
    • 2021-07-20
    66 min

    OREX-280 Sakura-chan

  • amateur censoredcreampieamateurorexorex-280orex280orex-280
    • 2021-07-22
    101 min

    ICRM-023 Riria

  • amateur censoredamateuricrmicrm-023icrm023icrm-023
    • 2021-08-05
    64 min

    336KNB-166 The Wife Who Decided To Appear In AV With The Hope Of Her Husband! Just Insert It And Tighten The Vagina With A Squeaky Face And Panting With A Fascinating Face! I Will Take A Gonzo With This Married Woman From Now On. 59 At Ushiku City, I

  • amateur censoredmarried womanamateurknbknb-166knb166336knb-166
    • 2021-08-07
    169 min

    [SCPX-430]Teeny Tiny Micro-Bikini And Lotion Makes A Hot Amateur Cutie Blush - It Was Supposed To Be Thigh Sex But She Was So Slippery The Cock Slipped Right In! "I Said Not To Stick It In Me..." But Her Request Is Ignored And Results In A Ho

  • censoredcreampiebig titsSCPXk m producescoop kmpSCPX-430SCPX430scpx00430
    • 2021-08-12
    109 min

    [SPRD-1443]Mother-In-Law, You Are Way Better Than My W-, Wife... Suzuka Aoyama

  • ryoka aoyama censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1443SPRD144318sprd01443
    • 2021-08-21
    56 min

    FC2PPV 2059124 [First Shot] Continuous Vaginal Cum Shot To A 50-Year-Old Managing Director Who Is Too Beautiful ☆ "Pants Are Flashy. Managing Director" 27 Years Of Service Ejaculation With A Beautiful Married Woman With A Nice Ass At High Spe

  • amateur uncensoredfc2
    • 2021-08-29
    61 min

    [HEYZO-2600]Chihiro Hinata Naughty Teacher -She Deprived Me Of My Virginity-

  • chihiro hinata uncensoredcreampiehandjobheyzo
    • 2021-09-01
    124 min

    [NACR-451]Real College Girls Working In A Part-time Job Where Creampies Are Allowed - Rin Miyazaki

  • miyazaki rin censoredcreampieblowjobNACRplanet plushimurokkushichi ku ryuuNACR-451NACR451h-237nacr00451
    • 2021-09-09
    82 min

    [IENF-164]"Is It Bad That My First-time Partner Is Lewd Like Me？" You"re A Cherry Boy If You Confess Your Feelings For An Exceptionally Lewd Classmate？ Let"s Give It A Shot First! Her Naive Demeanor Is A Change From Normal, But It Mak

  • himari ayase niko nekomura censoredcreampieslutIENFienergytiger kosakaiienfIENF-164IENF1641ienf00164



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download