ito sharan




FC2STARSSSISCJODEBODJUFEHDKADTTMIDEPPPDCAWDSHKDVEMAPREDLULUSANMIAARBDWANZHMNMILK

2020-11-29
133 min

[CHCH-002]We Were Doing A Town Hall Cleanup And This Colossal Tits Slut Housewife Was Wearing Tight Pants Over Her Big Ass And Shaking Her Butt To Lure Me To Temptation Rumi (30 Years Old)

  • censoredcreampiemilfCHCHbreasts and mother emmanielbreasts and motherCHCH-002CHCH002chch00002
    • 2020-12-13
    240 min

    [KDMI-030]Unreal Panty Hose Legs Amazing

  • mitani akari sena ai censoredKDMImilldopamixKDMI-030KDMI030kdmi00030
    • 2020-12-14
    67 min

    FC2PPV 1606858 [First time limited 1980] Pure girls who worked at the airport take a gonzo because of hardship ❤️ 20-year-old Wakeari beauty ❤️ Insert an old man meat stick into a young pussy with strong vaginal pressure ❤️ Raw vaginal cum shot in th

  • amateur uncensoredfc2
    • 2020-12-18
    111 min

    [ENFD-5908]本能のままに 金子智美

  • tomomi kaneko censoredENFDe.net frontierENFD-5908ENFD59085085enfd05908
    • 2020-12-21
    141 min

    [GENT-157]"This Feels Naughty..." Breeding The Fit Slut You Met At The Gym (While Training)! "Please Forgive Me Honey..." She's Engaged To Her Boyfriend, But Your Creampie Is Going To Knock Her Up First!

  • censoredcreampieGENTgentle man mousouzokugentlemangentleman mousouzokuGENT-157GENT157gent00157
    • 2020-12-24
    39 min

    FC2PPV 1618314 [Personal shooting] ♀ 250 Reading More ◯ -chan 18 years old SP01 2020 Christmas special edition! A beautiful girl is conceived as a child seed juice gift (laughs)

  • amateur uncensoredfc2
    • 2020-12-26
    64 min

    FC2PPV 1621423 Limited sale for 3 days! You can’t eat with just the unemployment allowance …

  • amateur uncensoredfc2
    • 2021-01-16
    66 min

    FC2PPV 1646673 [No] [Limited number of 1000pt OFF!] Innocent with a shortcut ❤️ Serious and ugly girl working at a major convenience store chain ❤️ What! Cry before insertion … Somehow vaginal cum shot ❤️ [First and last work]

  • amateur uncensoredfc2
    • 2021-01-16
    104 min

    [hoi-155]Iちゃん(21)

  • amateur censoredbig titsamateurhoihoi-155hoi155hoi-155
    • 2021-01-17
    100 min

    [OMHD-003]A Collection Of Barely Legal Babes, Hooked Up And Ready To Go This Barely Legal Babe Can Feel Her Body Gradually Going Numb And Stiffening Up As She's Turned Into A Visual Specimen Ai Kawana

  • ai kawana censoredblowjobsingle workOMHDdogmamigiwa otaOMHD-003OMHD003omhd00003
    • 2021-01-17
    102 min

    [BBTU-005]Big Titty Sub - Masochist With Colossal Tits Cums Hard Nanami Matsumoto

  • nana matsumoto censoredbig titsblowjobBBTUdogmatenunmy big titsBBTU-005BBTU005bbtu00005
    • 2021-02-12
    134 min

    [KBI-053]She Commits Adultery With Her Naughty Body. A Throbbing, Instantly Cumming, Sensual Maso Body A Former Music Teacher 3 Deep And Rich Fucks!! Minaho Ariga

  • ariga minaho censoredbig titsmature womanKBIprestigesamansa tabatakanbiKBI-053KBI053118kbi00053
    • 2021-02-17
    53 min

    FC2PPV 1690428 Oil that cramps in 5 minutes after applying] J cup huge breasts wife 27 years old Free massage pick-up on SNS for a married woman suffering from stiff shoulders. Pretending to be a serious treatment, pleasure fell in 05 minutes. Unstop

  • amateur uncensoredfc2
    • 2021-02-18
    68 min

    SIRO-4416 [First shot] [Taste SS class body] [Unfaithful wife covered with carnal desire] A child-bearing wife who seems to be in the kitchen garden feels the pleasure of others .. Application amateur, first AV shooting 194

  • amateur censoredbig titsmarried womansirosiro-4416siro4416siro-4416
    • 2021-02-19
    200 min

    [FCH-073](Online Only) You Won't Stop Cumming! Beautiful Girls Give Incredible Handjobs! 10 Gorgeous Babes Jerk Off Cocks For 200 Minutes!

  • horikita wa kira ri censoredbeautiful girlslutFCHprestigefetish partyFCH-073FCH073118fch00073
    • 2021-02-21
    61 min

    SIRO-4415 [First shot] [Neat OL pleasure fallen] [G milk shaking hard SEX] Healing beauty who squeaks her crotch and culminates many times. Big breasts increase the power of beauty every time it shakes .. Application amateur, first AV shooting 195

  • amateur censoredbig titssquirtingsirosiro-4415siro4415siro-4415
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-26
    52 min

    [ETQR-202](Daydream POV) Creampie Sex With A Beautiful Girl In A Sailor Uniform Shizuku 04

  • censoredcreampieuniformETQRerotic timeETQR-202ETQR202h-1186etqr00202
    • 2021-03-06
    239 min

    [TSP-439]Drilled By A Massive Dick Hammer! Female Foreman Gets Drilled! "You'll Catch A Cold If You Lay Down Here..."

  • censoredcreampieamateurTSPtokyo specialmanji groupTSP-439TSP439tsp00439
    • 2021-03-13
    41 min

    H4610 ori1751 Rikako Akabori 20years old

  • amateur uncensoredh4610
    • 2021-03-16
    133 min

    [ACZ-007]The Sex Pet Collector Vol.05 The Domesticated Widow Risa

  • censoredamateurbdsmACZsanwa publishingabnormal.companiesACZ-007ACZ007h-019acz00007
    • 2021-03-20
    120 min

    [NXG-361]Blushing Amateur Wife Can't Believe She's So Wet And Horny After Taking A Shameful High Paying Job...

  • censoredamateurcosplayNXGstar paradisenext groupNXG-361NXG361h-254nxg00361
    • 2021-04-08
    122 min

    [FSDSS-203]Cumming For The First Time! 4 Orgasms Super Beautiful Girl All Sex Special Momo Honda

  • honda peach censoredsquirtingblowjobFSDSSfalenomusetafaleno starFSDSS-203FSDSS2031fsdss00203
    • 2021-05-07
    155 min

    [MIAA-433]The Dominatrix I Used To Hire Has Become My Boss？! Now This Super Slut Has Taken Our Relationship To Work And Makes Me Cum Whenever She Wants... Riho Fujimori

  • riho fujimori censoredcreampiebig titsMIAAmoodyzbungo maedaeveryone s porn starMIAA-433MIAA433miaa00433
    • 2021-05-08
    23 min

    FC2PPV 1807627 Blow and ball licking of highleg gal ♥ Finally squeeze semen with handjob [Review benefits available]

  • amateur uncensoredfc2
    • 2021-05-09
    74 min

    300MAAN-651 [Woman with two Ma ○ Ko] Overwhelming beauty’s mouth Ma ○ The best blowjob that comes out from this, and the Yarichin man who is a hundred battles is also outbursts! !! A small devil girl who is inevitable in love blames herself with

  • amateur censoredbig titsamateurmaanmaan-651maan651300maan-651
    • 2021-05-20
    240 min

    [MGDN-152]Seducing And Fucking The Older Woman From The Housekeeping Service 10 Women 4 Hours

  • mitsuko ueshima maria sendo censoreduniformmature womanMGDNstar paradisemegadonMGDN-152MGDN152h-254mgdn00152
    • 2021-05-21
    148 min

    [CAWD-221]"God I Love Deep Throating Cock!" College Girl From Hakata Makes Her Porn Debut - Kururi, Age 20 - Her Throat Is An Erogenous Zone - Her Drooling, Eyes Watering Creampie Debut Kururi Ichimiya

  • ichinomiya quruli censoredcreampiebeautiful girlCAWDkawaiimichiru arashiyamaCAWD-221CAWD221cawd00221
    • 2021-05-21
    119 min

    [NNPJ-451]She Wants More Fuckbuddies - Amateur Uses A Dating App To Fun More Men Who'll Fuck Her - Creampie Sex From Dusk Until Dawn In Shibuya Riria

  • censoredcreampieNNPJnanpa japanNNPJ-451NNPJ451nnpj00451
    • 2021-05-22
    114 min

    [NSPS-995]The Case OF A Couple Held Hostage, Where The Wife Was Used As A Tool For Men To Relieve Their Libido From Morning Till Night Hikaru Konno

  • hikaru konno censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-995NSPS995nsps00995
    • 2021-05-27
    157 min

    [fc2-ppv 1837970]【お買い得】緊急事態宣言再延長セール！！3Qから怒涛の3SEX！ FC2-PPV-1837970

  • amateur uncensoredfc2
    • 2021-07-14
    59 min

    494SIKA-098 "I Can’t Stand It" It’s Time To Stop Playing And Putting Up SEX

  • amateur censoredcreampieschoolgirlsikasika-098sika098494sika-098
    • 2021-07-15
    21 min

    HEYZO 2567 Mari’s Amazing Hand Job – Mari Koizumi

  • mari koizumi uncensoredhandjobcumshotheyzo
    • 2021-07-17
    120 min

    [JUL-651]A Shocking Transfer No.2!! Her First True NTR Video!! Husband-And-Wife Swapping NTR Shocking Infidelity Videos Of My Wife And A Friend, Fucking By The Window Rinka Tahara

  • rinka tahara censoredbig titsmature womanJULmadonnajotaro tomiJUL-651JUL651jul00651
    • 2021-07-18
    240 min

    [MKMP-408]2020 User Approval Rate: BEST 4 Hours Of The Year - The Most Replayed Top 20 TItles

  • sakura kizuna miku abe censoredcreampiebig titsMKMPkm producetaro kmillionMKMP-408MKMP408mkmp00408
    • 2021-08-05
    176 min

    [SHIND-013]Record Of Persistent Stalker M: Pervert On The Train And Invasion Of A Residence, #25 26

  • censoredamateurSHINDshinkirousuzuki o maSHIND-013SHIND013h-1560shind00013
    • 2021-08-07
    125 min

    [REAL-774]"I"m Going To Send You Straight Down To Sweet Hell" A Sweetly Sadistic Beautiful Girl Is Explosively Sucking Out Boys" Semen Until They Go Insane! Endless Insanity And Sweet And Squishy Pussy-Pounding Sex! Hana Shirato

  • white peach censoredcreampieblowjobREALk m producesamoarireal real worksREAL-774REAL774real00774
    • 2021-08-12
    158 min

    [SPRD-1445]My Sex Friend From That Time Is... My Friend"s Mother - Kana Morisawa

  • kana morisawa kanako iioka censoredmature womansingle workSPRDtakara eizouohare konaleddinSPRD-1445SPRD144518sprd01445
    • 2021-08-19
    81 min

    FC2PPV 2048861 [3980 → Limited Number 1980] Do You Like Beautiful Nursery Teachers ❤️ Nasty Nursery Teachers Who Masturbate Every Day ❤️ Experience Real Habits With Sex For The First Time In A Year And A Half ❤️ Nasty Nursery Teachers Who Can Not Sto

  • amateur uncensoredfc2
    • 2021-08-20
    120 min

    [CAWD-274]The Baseball Team Manager Who Used To Treat Me Like Trash And Bully Me Is Now A Callgirl...Hehe! How I Reversed The Game And Hit A Home Run Creampie With My Rusted "Bat". Mei Mizuki

  • mei mitsuki censoredcreampiebig titsCAWDkawaiikitorune kawaguchiCAWD-274CAWD274cawd00274
    • 2021-08-26
    184 min

    [NHDTB-570]Out Here？! College Girl Sucks My Dick With a Smile And Doens"t Even Stop After I Cum On Her Face, But Beggs For a Second Round 7

  • censoreduniformblowjobNHDTBnatural highcenter yamauchiNHDTB-570NHDTB5701nhdtb00570
    • 2021-08-27
    132 min

    [SHIC-219]My Wife Left Me... And My Stepdaughter Took Over For Her...

  • censoredbeautiful girlSHICshishunki.comSHIC-219SHIC219h-839shic00219
    • 2021-08-28
    123 min

    [ITSR-095]Filthy Hidden Footage Of The Unequaled Chairman Ravishing A Woman From A Mountain Village 2

  • censoredcreampieamateurITSRbigmorkalmaxchou itadakiITSR-095ITSR09557itsr00095
    • 2021-09-04
    127 min

    [EMBZ-233](Caution Before Viewing) A G*******g Fuck Fest Video Uncut And Unedited A Video Record Of Sins Against Women A Voluptuous Lady Is Detonated! This Plain Jane Colossal Tits Housewife In Glasses Is Going Cum Crazy With Aphrodisiacs And Orgasmi

  • shiori tsukada censoredcreampiesingle workEMBZjuku onna juku emmanuellejuku onna jukuEMBZ-233EMBZ233embz00233
    • 2021-09-15
    481 min

    [RVG-141]Mom"s Real Sex Education Best Hits Collection vol. 7

  • yuri chitose mika ichijo censoredmilfdramaRVGglory questRVG-141RVG141rvg00141
    • 2021-10-01
    119 min

    [NNPJ-476]Real On-The-Street Interview In Kabukicho. We Found Broke, Runaway Girl Koharu In the To-Yoko Neighborhood, Then Took Her Back To Our Place To Use As A Fucktoy

  • censoredcreampieblowjobNNPJnampa japanNNPJ-476NNPJ476nnpj00476
    • 2021-10-02
    242 min

    [MMB-387]The Best Part Of Sports Day Is Beautiful Girl Pussy Hard Cock Creampie Exercise!!! I"m Lost When It Comes To Exercise, And It"s Sports Day And I Need It, So I Tried Out Hard Cock Physical Training With My Crush"s Pussy! Without A

  • censoredcreampiebeautiful girlMMBmomotarou eizou shuppanishikiribashi hakasemomotaro bestMMB-387MMB387mmb00387
    • 2021-10-15
    197 min

    [MIDE-986]Tsubomi 15-Year Anniversary! Here To Stick Around For More To Come？ Sudden Amateur Thanksgiving! Reclusive Masochistic Guy Gets A Visit At Home For A Nice Delivery Of Hardcore Sex.

  • bud aika censoredcreampieslutMIDEmoodyzzampamoodyz divaMIDE-986MIDE986mide00986



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download