housewife javcensored amateur censored high vision




FC2HMNPREDDTTWAAAMIAASANFSDSSMIDVAMBIRBDMVSDSSNIDASDCESDPPPDGMEMROYDHUNTBAUKGSSIS

2020-12-05
120 min

[SHKD-915]I'll Never Forget The Man Who Ravished Me... Hijiri Maihara

  • kiyoshi maihara censoredSHKDattackerstakuo otanideath night evilSHKD-915SHKD915shkd00915
    • 2020-12-11
    59 min

    FC2PPV 1590468 [Personal shooting] Kotori 32 years old, a large amount of vaginal cum shot to a beautiful wife with a sensitive body in agony

  • amateur uncensoredfc2
    • 2020-12-17
    49 min

    285ENDX-318 Fair-skinned H cup 24 years old! Creampie SEX video that has appeared with the teacher of the cram school prepared for barre

  • amateur censoredcreampiesquirtingendxendx-318endx318285endx-318
    • 2020-12-18
    59 min

    FC2PPV 1611460 1000pt OFF until December 24th !! [No / Piece] My lover is Santa Claus !？ My beloved Nana turns into Santa, and the hot spring effect causes a big squirt from her pussy !？ This winter’s best vaginal cum shot! ! * There is a face-u

  • amateur uncensoredfc2
    • 2021-01-01
    138 min

    [FLAV-259]HYPER FETISH A Naughty Queen In A High-Cut Outfit Alice Otsu

  • otsu alice censoredsquirtingsingle workFLAVdigital arkdigital ark digital arkFLAV-259FLAV259flav00259
    • 2021-01-06
    56 min

    FC2PPV 1634401 Very beautiful woman] Former idol housewife, 25 years old, a wife who can’t get rid of her SEX habit playing in the entertainment world! Get out during a couple date and have sex with others! The whole story of a horny slut who is

  • amateur uncensoredfc2
    • 2021-01-07
    73 min

    FC2PPV 1636139 [Urgent erotic situation declaration! ] Super sexy ♥ Whitening gal OL and Ran Paco! Personal shooting already messed up “Dense contact prohibited ➡ SEX rolled” “Emergency contraception declaration ➡ Vaginal cum shot̶

  • amateur uncensoredfc2
    • 2021-01-09
    115 min

    [DASD-794]CLose Up. Shemale Squeen Mayumi Harukaze

  • spring wind mayumi censoredsingle workDASDdashajime yanaiDASD-794DASD794dasd00794
    • 2021-01-09
    150 min

    [FFFS-024]Taking Mature Women Home! Married Women Playing With Other Guys' Cocks 21 - Tall Women With Beautiful I-Cup Tits Get Off On A Younger Guy's Dick! - Ayako-san, I-Cup, 40yo, 176cm Tall, Takes The Lead- Masumi-san, I-Cup, 45yo, 180cm T

  • censoredmature womanslutFFFSmature woman private videos emmanuellemanji groupFFFS-024FFFS024fffs00024
    • 2021-01-11
    180 min

    Pacopacomama 011121_419 Natsuki Kikuta, Yurina Shiratori, Rie Masuko, Saori Hoshino, Manami Ueno

  • natsuki kikuta rie masuko uncensoredcreampiebig titspacopacomama
    • 2021-01-23
    118 min

    [JUL-449]Guy She Doesn't Like Makes Her Cum So Hard She Could Die... Aoi Nakajo

  • nakagusuku censoredmature womansingle workJULmadonnajo asagiriJUL-449JUL449jul00449
    • 2021-01-30
    122 min

    [MIAA-386]Machine Gun Cumshot Titty Fuck Soapland Girl Nene Tanaka

  • nene tanaka censoredbig titssingle workMIAAmoodyzeighteveryone s porn starMIAA-386MIAA386miaa00386
    • 2021-02-22
    84 min

    [MCKT-016]Hot Girls Who Love To Party! Girls Pick Up Guys To Fuck On The Street Corner Hibiki Otsuki

  • otsuki sound censoredcreampieMCKTchikikikikama delusion groupMCKT-016MCKT016mckt00016
    • 2021-02-22
    116 min

    [ANZD-066]Her First Sugar Daddy Hunt - A Maso And Secretly Horny Intellectual Babe, Miku-chan (J-Cup Titties) -

  • censoredcreampiebig titsANZDapricotANZD-066ANZD066anzd00066
    • 2021-03-15
    362 min

    [YPTS-003]True Stories! Sugar Daddy Insertion: Amateur POV Leaked Pictures 2

  • censoredcreampiebig titsYPTSpetersYPTS-003YPTS003h-021ypts00003
    • 2021-03-21
    151 min

    [CAWD-188]I Spent Three Whole Days When My Cruel Domineering Boss Was Out Of Town Getting Revenge By Fucking His Young Wife Out Of Her Mind Moko Sakura

  • sakura moko censoredcreampiesingle workCAWDkawaiihiroyuki kimuraCAWD-188CAWD188cawd00188
    • 2021-04-03
    65 min

    SIRO-4426 [First shot] [THE neat and clean girl] [Mochijiri cowgirl] A neat and clean girl who has been aiming to be a nursery teacher since she was a junior high school student takes a peek into the H world. The uncle’s technique that I taste f

  • amateur censoredamateursirosiro-4426siro4426siro-4426
    • 2021-04-05
    35 min

    FC2PPV 1755831 Up to 12 1480 [No] ＃ Slender and big breasts saffle. It goes out of control in her vagina.

  • amateur uncensoredfc2
    • 2021-04-14
    125 min

    [ARM-971]Urara Kanon's All-POV Masturbation Support - She'll Turn You On With Her Jungle Bush!

  • hanaoto urara censoredanalsingle workARMaroma planningmania satoshiaromaARM-971ARM971arm00971
    • 2021-04-15
    117 min

    [OMHD-006]Shocking Mental Experiment - "How To Reproduce Pavlov's Dog In Real Life" - S********l Administered Electric Shocks To Transform Her Into A Total Cock Slut. Hinako Mori

  • hinako mori censoredschoolgirlsingle workOMHDdogmamigiwa otaOMHD-006OMHD006omhd00006
    • 2021-04-17
    175 min

    [HND-976]Only Two Pornos Into The Biz And She's Ready For A Creampie! Her Pussy Overflowing With Creamy Jizz... Her First-Ever Raw Creampie Mai Kagari

  • flower hunting censoredcreampiebeautiful girlHNDhon nakamametaro mamezawaHND-976HND976hnd00976
    • 2021-04-18
    125 min

    [TKSH-020]Milky Masochistic Basketball Athlete - Miu Sugihara

  • miu sugihara censoredcreampiebig titsTKSHtoyohikochain demonyunkaiTKSH-020TKSH020tksh00020
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-29
    60 min

    FCP-013 [Delivery only] I love subjectivity! !! Be careful too much! !! There is no waiting for ejaculation with a handjob! 1

  • amateur censoredamateurbeautiful girlfcpfcp-013fcp013fcp-013
    • 2021-05-05
    84 min

    435MFC-103 [Future Female Anna Candidate! ] But, in fact, Gonzo with a super carnivorous JD that is a spear man bitch that eats up a man! Whether it’s fingering or electric massage, it blows the tide. !! 2 consecutive rich sexual intercourse of

  • amateur censoredcreampiesquirtingmfcmfc-103mfc103435mfc-103
    • 2021-05-05
    120 min

    [GVH-228]Perverted Wife Who Likes To Turn Men On By Not Wearing A Bra Or Panties Moved Next Door! Rika Tsubaki

  • tsubaki rika censoredslutsingle workGVHglory questkabin kizakuraGVH-228GVH22813gvh00228
    • 2021-05-06
    76 min

    200GANA-2482 Seriously Nampa, first shot. 1632 I should have just shown a picture of my pet … A slender busty beauty who has been played with her chemo ears before I knew it! There is a pet’s qualities, a figure that hangs down and hangs do

  • amateur censoredbig titsamateurganagana-2482gana2482200gana-2482
    • 2021-05-08
    245 min

    [KDMI-035]High Leg Fantasy Amazing

  • kimishima mio yano tsubasa censoredKDMImiludopamixKDMI-035KDMI035kdmi00035
    • 2021-05-10
    96 min

    374IMGN-012 Mie (26)

  • amateur censoredcreampieamateurimgnimgn-012imgn012374imgn-012
    • 2021-05-20
    122 min

    [IENF-142]Amateur Pick Up Naive College Girl Has Her First Experience At A Brothel For Ladies 2

  • aina hayashi rina takase censoredcreampieamateurIENFienergytiger kosakaiienfIENF-142IENF1421ienf00142
    • 2021-05-22
    240 min

    [MKMP-399]SUPER COMPLETE BEST Yu Shinoda

  • shinoda yu censoredcreampiebig titsMKMPkm producetaro kmillionMKMP-399MKMP399mkmp00399
    • 2021-05-28
    147 min

    [JUFE-293]Sexual Chiropractic NTR And The College Girl This Chiropractor's Secret Techniques Were So Amazing, It Doesn't Matter If My Boyfriend Is Here, He Made Me Cum Over And Over Again Mahiro Ichiki

  • mahiro ichiki censoredsingle workJUFEfitchJUFE-293JUFE293jufe00293
    • 2021-06-03

    FC2PPV 1851396 [Individual shooting 40] Complete appearance 18-year-old pie bread J 〇 Creampie to Miss Refre

  • amateur uncensoredfc2
    • 2021-06-17
    95 min

    [CHERD-076]"I Know It's Your First Time, But Would You Rather Not Fuck An Old Lady Raw？" A Cherry Boy Has The Greatest Cherry Popping Good Time Of His Life With A Married Woman/Mature WOman Kanako Horimi

  • miyako hori censoredcreampiemarried womanCHERDcenter villagekotaro misatohanazono center villageCHERD-076CHERD076h-086cherd00076
    • 2021-06-25
    31 min

    FC2PPV 1886565 First shot! !! Limited number [Uncensored] Creampie twice to the most beautiful waitress I met at the family restaurant! !! (Feature film)

  • amateur uncensoredfc2
    • 2021-07-01
    120 min

    [NACR-439]In My Daydream About My Son's Wife... Amu Hanamiya

  • hanamiya amu censoredcreampiebig titsNACRplanet plussakura ninshichi ku ryuuNACR-439NACR439h-237nacr00439
    • 2021-07-01
    120 min

    [NACR-438]An Outrageous Promise With My Husband's C***d From A Previous Marriage. Yuri Sasahara.

  • yuri sasahara censoredcreampiemature womanNACRplanet plussakura ninshichi ku ryuuNACR-438NACR438h-237nacr00438
    • 2021-07-08
    104 min

    [SPRD-1436]I Was Invited By My Stepmom Chisato Shoda

  • shota chisato censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1436SPRD143618sprd01436
    • 2021-07-13
    244 min

    [STARS-403]What's So Wrong With Being Lovers？ This Beautiful Lady Is Of The Highest Grade, And She Never Gets Excited Unless She's Committing Adultery, And Now You Get To Have Endless Cuckolding Sex Until The Break Of Dawn! A Graduation Comme

  • hiiragi kaede censoredslutSTARSsod createcrestsod starSTARS-403STARS4031stars00403
    • 2021-07-14
    108 min

    [SPRD-1440]There's Nothing Like My Older Ex-Wife, Starring Rina Takakura

  • takakura rina censoredmarried womansoloworkSPRDtakara eizokyuta tukumoaleddinSPRD-1440SPRD1440
    • 2021-07-17
    121 min

    [CAWD-256]"In My Family, We Hang Around In The Nude" I Can't Resist My Girlfriend's Sister's Adolescent Tits... I Spent The Two Weeks Of My Summer Studies Over At Her Place Banging Her Behind My Girlfriend's Back Haruka Kishi

  • haruka kishii censoredbig titsschoolgirlCAWDkawaiikyoseiCAWD-256CAWD256cawd00256
    • 2021-07-23
    41 min

    FC2PPV 1936211 Appearance! !! Limited Price Up To 500 Pieces! !! [Uncensored] A Long-Sought Reunion With A Beautiful Girl Who Happened To Meet In The City! !! Creampie In A Beautiful Body Wrapped In Clear Skin! !! (Part 1)

  • amateur uncensoredfc2
    • 2021-07-30
    143 min

    [JUL-667]A Madonna Exclusive: Giving The Green Light For Creampies In A Married Woman, Who Is A Peerless Bunny!! Overly Dense Adultery For The Dark. Iori Takahira

  • high ratio good cage censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-667JUL667jul00667
    • 2021-08-15
    115 min

    [083PPP-2213]サオあり美人ニューハーフSEX10連発！女をハメて男に掘られてチンポもアナルもフル稼働(4)

  • amateur censoredamateurpppppp-2213ppp2213083ppp-2213
    • 2021-09-02
    102 min

    FC2PPV 2100183 [1,000pt Pokkiri] Yuka All-You-Can-Eat Her Who Came When Her Boyfriend Told Her To "Tell Me About Debt Repayment"! Nitrogen ○ A Large Amount Of Rich Sperm Is Shot On The Face In Irama ♪ Geki Saddle Thrusting [With Bonus]

  • amateur uncensoredfc2
    • 2021-09-03
    178 min

    [DVDMS-708]A Clear Beauty That Charms Men. Former Entertainer Mika Kisaragi, 29, "I"m going to be a married woman soon". Debuted In Porn Without Telling Her Fiance

  • mika kisaragi censoredsingle workDVDMSdeepsbiba gonzoDVDMS-708DVDMS708dvdms00708
    • 2021-09-20
    180 min

    [OFKU-190]This Hot Mama Has A Normal Body But A Big Juicy Ass, And When I Went To See Her, She Surprised Me By Greeting Me While Wearing A Thong ... Horny Happenings Lead To Illicit Activities 180 Minutes

  • censoredcreampielingerieOFKUstar paradiseofukuro tetsudouOFKU-190OFKU190h-254ofku00190
    • 2021-09-28
    71 min

    324SRTD-0246 Cheating Video Shooting To Attract Your Boyfriend! ？？ I Should Have Forgotten The Purpose And I’m Serious! (Moe Hazuki)

  • amateur censoredcreampieamateursrtdsrtd-0246srtd0246324srtd-0246



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download