housewife amateur high vision creampie censored




FC2HODVVENXFSDSSNNPJSSNIAUKGGMEMMEYDCESDWAAASQTEATIDMARAADNNACXDTTONEZAUKGCJODRBD

2020-11-13
68 min

HEYZO 2413 First Time Anal Sex Just For Pocket Money – Myu Nakayama

  • myu nakayama uncensoredheyzo
    • 2020-11-26
    45 min

    FC2PPV 1584358 Limited discount for the first 20 bottles [5000 → 1980] 175cm de М Former model Sex slave screaming sex & privilege 3P with unknown number of deaths

  • amateur uncensoredfc2
    • 2020-12-01
    123 min

    [AMBI-115]My Homeroom Teacher And Me Are Living A Secret Lovey-Dovey Newlywed Sex Life Together Urara Kanon

  • hanaoto urara censoredcreampieschoolgirlAMBIplanet plusdirector oanbibaresotsuAMBI-115AMBI115h-237ambi00115
    • 2020-12-03
    98 min

    [HONE-255]MILF In Her Fifties Wants To Take Her Own Stepgrandson's Virginity Makiko Tsurukawa

  • makiko tsurukawa censoredcreampiemature womanHONEcenter villageminatoyaflower gardenHONE-255HONE255h-086hone00255
    • 2020-12-05
    118 min

    [JUL-392]Celebration! The 50th Work In The Series!! Mom's Friend - Hiroka Suzuno

  • hiroka suzuno censoredmature womanslutJULmadonnajyoji kawaiJUL-392JUL392jul00392
    • 2020-12-06
    42 min

    FC2PPV 1596878 [Limited time sale! 2580pt → 1880pt until 12/20] [Complete clothing] [4K shooting] Good woman good clothes, black pantyhose (direct wear), overflowing pheromones of working amateur women

  • amateur uncensoredfc2
    • 2020-12-11
    70 min

    FC2PPV 1602106 [No 3-pack] Creampie ban lifted! !! Lori girl Miu 18 years old Cum shot for the first time in my life! !! A total of 3 hours with 2 past works Miu-chan complete pack! 【selfie】

  • amateur uncensoredfc2
    • 2020-12-22
    140 min

    [MSFH-044]Two Lovers Cooped Up In A Hotel Room For One Whole Day To Indulge In Creampie Sex From Morning Until Night Madoka Shizuki

  • madoka shizuki censoredcreampiebig titsMSFHsod createsuisei akaims sodMSFH-044MSFH0441msfh00044
    • 2021-01-04
    48 min

    FC2PPV 1631980 ☆ First shot ☆ Complete appearance ☆ Frustrated beauty OL gave her boyfriend the first Gonzo in Naisho ♥ I shot a lot to the back of the vagina ♪ [With review benefits]

  • amateur uncensoredfc2
    • 2021-01-09
    114 min

    [MUDR-137]Ever Since That Day... Breaking In A Beautiful Y********l In Uniform With S&M Creampie Sex Mahiro Ichiki

  • mahiro ichiki censoredcreampiebdsmMUDRmukuMUDR-137MUDR137mudr00137
    • 2021-01-11
    81 min

    259LUXU-1367 Luxury TV 1351 As a business owner, as a mother with children … A little stimulating play with fire in your busy days … I want to forget my family only today and be disturbed by my desires! It is a must-see for a beautiful marr

  • amateur censoredbig titsmarried womanluxuluxu-1367luxu1367259luxu-1367
    • 2021-01-13
    47 min

    302GERK-339 A-san

  • amateur censoredcreampiebig titsgerkgerk-339gerk339gerk-339
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-15
    30 min

    FC2PPV 1645123 [Limited time sale] Momo-chan’s latest work! Special price this time including 2 past works!

  • amateur uncensoredfc2
    • 2021-01-20
    119 min

    [SPZ-1092]Cash For Pics - Beautiful Honor S*****t Is A Secret Slut With Blossoming Tits

  • censoredschoolgirlbeautiful girlSPZstar paradisestar paradiesSPZ-1092SPZ1092h-254spz01092
    • 2021-02-24
    54 min

    FC2PPV 1699790 [Personal shooting] Tsumugi 22 years old, a large amount of vaginal cum shot to a neat and clean amateur beautiful breast slender female college student

  • amateur uncensoredfc2
    • 2021-03-01
    64 min

    492MERC-238 Innocent erotic curiosity

  • amateur censoredamateurmercmerc-238merc238492merc-238
    • 2021-03-13
    135 min

    [DVAJ-504]I Dumped This Plain Jane Loser College Girl Last Month, But Now She's Wearing A Blatantly Sexy One-Piece Knit Dress And Trying To Tempt Me, And I Think I'm Hitting The Limit Of My Resistance Ruka Inaba

  • inaba censoredcreampiebig titsDVAJalice japankirinDVAJ-504DVAJ504dvaj00504
    • 2021-03-29
    46 min

    276KITAIKE-494 Kaori

  • amateur censoredamateurkitaikekitaike-494kitaike494276kitaike-494
    • 2021-04-02
    111 min

    483SGK-020 [Impact problem work] [* Handling caution] [G milk horny beast monster] [Iki crazy lunch key 4P] [Continuous vaginal cum shot] [Actually a solid bank clerk] Everyone, this time is really an incident! !! Shocking problem work Bomb! Invasion

  • amateur censoredcreampiebig titssgksgk-020sgk020483sgk-020
    • 2021-04-09
    120 min

    [KAM-080]I Seduced My Buddy's Girlfriend -> Secretly Filmed It -> Then Posted It Online (KAM-080)

  • censoredcreampiebig titsKAMkarmamanji groupKAM-080KAM080kam00080
    • 2021-04-16
    50 min

    230OREC-742 Nanao

  • amateur censoredcreampiebig titsorecorec-742orec742230orec-742
    • 2021-04-20
    90 min

    [FUFU-199]True Stories Experience With Infidelity: None We Deceived This Prim And Proper Wife By Asking Her To Go Visit A Friend And Give Him Some TLC, And Then We Left Them Alone So That He Could Seduce Her, And Then ... Aira Sonokawa (34)

  • aira sonokawa censoredbig titsamateurFUFUstar paradisefufuFUFU-199FUFU199h-254fufu00199
    • 2021-05-14
    45 min

    FC2PPV 1798960 Vacuum blowjob with plenty of saliva ♡ Thick semen bukkake on the face of a perverted erotic wife Massive facial cumshots ♡ Main story appearance ♡ Personal shooting 73

  • amateur uncensoredfc2
    • 2021-05-25
    53 min

    498DDH-018 [Deliher Voyeur] G-Cup Big Breasts Deli Miss Full Of Motherhood Heals With White Swimsuit Water That Bites Into The Pitch Pichi Raw Production!

  • amateur censoredcreampiebig titsddhddh-018ddh018498ddh-018
    • 2021-06-01
    63 min

    200GANA-2488 In the spear room of the Nampa master of 100 battles, bring in SEX hidden shooting 205 Innocent Musume with a dazzling smile and drinking at home! The blow job that makes a jubojubo sound is too erotic … The beautiful body that is t

  • amateur censoredamateurganagana-2488gana2488200gana-2488
    • 2021-06-03
    116 min

    [AKDL-115]Becoming A Sexual Prey At My New Job, The Whole Department Together

  • karen asahina yura marino censoredbig titsdramaAKDLaquinoriaquinoriaknrAKDL-115AKDL1151akdl00115
    • 2021-06-11
    150 min

    [C-2642]My Wif 95

  • hanai shizuku censoredmarried womanCgogostakeshi karakicore gogo sC-2642C2642
    • 2021-06-15
    126 min

    [KTRA-301]Creampie For My Slender, Beautiful Stepsister Suzu Monami

  • monami bell censoredcreampiebeautiful girlKTRAk tribeKTRA-301KTRA301h-094ktra00301
    • 2021-06-19
    220 min

    [REXD-366]The Girl Who Used To Bully Me... The Defeated Older Woman "Do You Remember Me？"

  • censoredcreampiebig titsREXDredgroupREXD-366REXD366rexd00366
    • 2021-06-20
    135 min

    [OPPW-097]French Kiss SOAP Sora Shinohara

  • sora shinohara censoredanalsingle workOPPWopenipeni world mousouzokuhimu lockOPPW-097OPPW097oppw00097
    • 2021-06-29
    121 min

    [SDDE-650]An Introverted S*****t Makes A Contract With A Succubus And Has Her Slut Debut! She Paralyzes Men With Her H*******m Powers And Turns Them Into Masochists! - Meru Kusumi

  • kusumi censoredcreampiecosplaySDDEsod createdazai chinposenzSDDE-650SDDE6501sdde00650
    • 2021-07-07
    65 min

    SIRO-4566 [First shot] [Soggy and obscene tongue technique] [Stress release SEX] A frustrated caregiver who is tired of daily hard work. If you greet the meat stick for the first time in 4 years, hold it in love and insert it all the way with your fa

  • amateur censoredamateursirosiro-4566siro4566siro-4566
    • 2021-07-30
    31 min

    481SACZ-053 Minami 1

  • amateur censoredamateurbdsmsaczsacz-053sacz053481sacz-053
    • 2021-08-13
    144 min

    [HUNBL-058]A Super Masochistic Slut Whose Deep Throat Gives Her Convulsive Climaxes At A Men"s Massage Parlor

  • censoredcreampieuniformHUNBLhuntergeminihhh groupHUNBL-058HUNBL058hunbl00058
    • 2021-09-03
    119 min

    [HODV-21604]Nasty Older Man Lures A Runaway Girl Back To His Place - Breaking In A Teen Runaway With Confinement Rara Kudo

  • lara kudo censoredcreampiebeautiful girlHODVh m pinugami ryouHODV-21604HODV216045642hodv21604
    • 2021-09-10
    126 min

    [BANK-053]Is This Naughty And Haughty Girl Cumming!？ A Super Cute Shaved Pussy Slender And Beautiful Gal Rika Aohitsugi

  • ao coffin censoredcreampieuniformBANKma ko ginkouyuuseiBANK-053BANK053h-1495bank00053
    • 2021-09-10
    135 min

    [VENX-072]A Stepmom And Stepson Who Start Having Sex Within 2 Seconds Of Dad Being Out Of The House Yuko Shiraki

  • shiraki yuko censoredcreampiebig titsVENXvenussarufakecest winntersVENX-072VENX072venx00072
    • 2021-09-10
    148 min

    [JUL-708]Tease Her ... Tease Her ... Tease Her ... Tease Her ... And At The Moment When She"s At Her Wettest, Insert Your Penis For Some Juicy, Luscious Adultery Sex. Ayaka Muto

  • ayaka muto censoredmature womansingle workJULmadonnamametaro mamezawaJUL-708JUL708jul00708
    • 2021-09-11
    159 min

    [XRLE-018]Married Woman Erupts From Anal Daydream. Anal Exploration. Hazuki-san (Alias) 25 Years Old. Moe Hazuki

  • moe hazuki censoredanalcreampieXRLEk m producesugino kireal real worksXRLE-018XRLE018xrle00018
    • 2021-09-30
    93 min

    355OPCYN-186 Karen 2 (Karen Asahina)

  • amateur censoredcreampiesquirtingopcynopcyn-186opcyn186355opcyn-186
    • 2021-10-01
    120 min

    [WAAA-106]Elegant, Sultry Female Boss Arranges For A Shared Room To Take Down A Dick. Reverse NTR Cheating Scenario. I Get 10 Cum Creampie Loads Off With Her Hot Tits And Huge Ass Till Morning. Riho Fujimori

  • riho fujimori censoredcreampiebig titsWAAAwanz factoryWAAA-106WAAA106waaa00106
    • 2021-10-06
    46 min

    229SCUTE-1132 Kanon (22) S-Cute Natural Cute M Woman And Etch (Natural Mizuki)

  • amateur censoredamateurbeautiful girlscutescute-1132scute1132229scute-1132
    • 2021-10-08
    119 min

    [DASD-925]Anal Guidance - Ayaka Mochidzuki

  • ayaka mochizuki censoredanaldeepthroatDASDdasmishima rokusaburoDASD-925DASD925dasd00925
    • 2021-11-07
    83 min

    300NTK-651 [Tall God G Boyne Beauty x Dirty Butt Half-Beautiful Girl’s Miracle Combination! !! ] [God Milk & Horny Butt Is The Last This Year! ？？ The Opening Of The Big Orgy That Concludes The Summer Festival! ？？ ] [A Wonderful Young Nympho C

  • amateur censoredcreampiebig titsntkntk-651ntk651300ntk-651
    • 2021-12-07
    61 min

    FC2PPV 2496948 Individual Shooting) Bed Soaked With Squirting Acme ♡ Idol Beautiful Girl Hikaru-Chan’s Serious Convulsions Echi Echi Gonzo Video ♡ [cen]

  • amateur uncensoredfc2
    • 2021-12-08
    45 min

    508HYK-018 Ikeike Sister ＃ 18 Tsubaki The Body Of A Mature Woman Who Enjoys Her Hard Orgy

  • amateur censoredcreampieamateurhykhyk-018hyk018508hyk-018
    • 2021-12-09
    235 min

    [STARS-482]感謝いっぱいボクらの彼女 小倉由菜デビュー4周年!終始イキっぱなし大痙攣!完全撮り下ろしほぼ4時間収録!!

  • ogura yuna censoredsoloworkSTARSsod createzampasod starSTARS-482STARS482



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download