hours more various occupations jav high vision censored




FC2WANZNATREBODABWMEYDAUKGWAAAMIAAAWDKSBJHODVCESDGVHSHKDCAWDAVSASPRDNACRAMBISDAB

2021-01-07
69 min

10musume 010721_01 Girl who longs for the entertainment world, came to the interview, so I had SEX Aiko Himeno

  • amateur uncensored10musume
    • 2021-01-12
    57 min

    FC2PPV 1641779 * Limited [Individual / Uncensored] Chibi Gal Shaved Loli Creampie Raw Saddle In A Beautiful Girl’s Immature Manko A White Cloudy Sujiman That Is Too Tight To Turn Up A Cute Ahegao Shake And Seeding Appeal ♥

  • amateur uncensoredfc2
    • 2021-01-15
    63 min

    300NTK-501 Reiwa No.1 Miss Kyaba Advent! !! If you insert a beautiful girl who is serving customers nowadays with a raw chin …! !! Slender beauty body shakes and warps Keiren continuous ascension! !! Echiechi sexual intercourse recording video o

  • nosex censoredcreampieamateurntkntk-501ntk501300ntk-501
    • 2021-01-22
    66 min

    [DHT-198]Picking Up First-Rate MILFs - Beautiful Mature Creampie Sex JAPAN - Ms Yuki, Age 40

  • censoredbig titsmarried womanDHThot entertainmentstudio zeroDHT-198DHT19859dht00198
    • 2021-01-23
    51 min

    FC2PPV 1656151 [Uncensored / Individual shooting] Shortcut active model, miracle style! !! Excited about the first Gonzo! [First shot * Immediate deletion of body baldness] * With benefits

  • amateur uncensoredfc2
    • 2021-01-29
    240 min

    [OKAX-699]Groping A Cleaning Lady With A Tasy Ass 4 Hours

  • censoreduniformmature womanOKAXk m producedick mandokuokazuOKAX-699OKAX69984okax00699
    • 2021-01-31
    248 min

    [GAV-059]MILFs In Their Fifties - Raw Creampies

  • censoredcreampiemature womanGAVgogo adult videosGAV-059GAV059gav00059
    • 2021-02-02
    37 min

    S-Cute pok_007 Gonzo with a beautiful woman with strong libido and a yukata H / June

  • june censoredamateurpokpok-007pok007pok-007
    • 2021-02-04
    31 min

    FC2PPV 1672482 [No] Affair wife with beautiful big tits. She is exposed outdoors in a public place and inserts another stick. She was begged for the second round at the hotel.

  • amateur uncensoredfc2
    • 2021-02-12
    132 min

    [SALO-036]女王様たちの流出したプライベート映像 ～サロメ外伝 vol.2～

  • censoredblowjobhandjobSALOk m producesaromeSALO-036SALO03684salo00036
    • 2021-03-11
    119 min

    [FSDSS-185]All Night Sex After Getting Caught In The Rain With My Female Coworker Nene Yoshitaka

  • nine yoshitaka censoredblowjobsingle workFSDSSfalenodragon nishikawafaleno starFSDSS-185FSDSS1851fsdss00185
    • 2021-03-16
    14 min

    FC2PPV 1728381 PREMIERE #４

  • amateur uncensoredfc2
    • 2021-03-21
    138 min

    [JUL-520]I Left My Womanizing Stepfather Alone With My Vulnerable Wife For A 3 Day Business Trip... Konoha Narumi

  • narumi kokun censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-520JUL520jul00520
    • 2021-04-10
    118 min

    [BAHP-073]Trying To Get Pregnant Porn "I Just Want A Baby!" 21 Year Old Woman Orgasms With Joy As Her Pussy Is Filled With Cum

  • censoredcreampieBAHPbaltandaibutsu yoshidahoppinBAHP-073BAHP073bahp00073
    • 2021-04-24
    131 min

    [RPIN-049]This Gal I Know Is Not Only A Seriously Naughty Little Bitch, But She Won't Put Out, So I Hired An Adult Video Actor To Make Her Cum Like A Little Obedient Orgasmic Cunt!

  • censoredRPINlycopene mousouzokukakeru ozoraRPIN-049RPIN049rpin00049
    • 2021-05-01
    240 min

    [HUNTB-001]"What!？ Really, You Want Me To Fuck You？" She's After My Cherry Boy Cock!？ The Class S*****t Council President Seemed Like A Hard Nut To Crack, But It Turns Out She's A Prim And Proper Slutty Bitch Who Loves To Fuck Cherry

  • censoredcreampieHUNTBhuntervolvo nakanohhh groupHUNTB-001HUNTB001huntb00001
    • 2021-05-07
    124 min

    [IPX-658]The New Girl At Work Seduced Me: Cheating With The Naughty Office Slut Karen Kaede

  • karen kaede censoredbeautiful girlslutIPXidea pocketdishIPX-658IPX658ipx00658
    • 2021-05-15
    146 min

    [BBTU-012](Delivery-Only Special Video Included) Titty Fuck Special J-Cup 110cm Unlimited Titty Fuck

  • chitose in the evening censoredbig titssingle workBBTUdogmatenunmy big titsBBTU-012BBTU012bbtu00012
    • 2021-06-04
    73 min

    230OREC-780 Natsu

  • amateur censoredcreampieamateurorecorec-780orec780230orec-780
    • 2021-06-06
    60 min

    SIRO-4542 [First shot] [Super model class beauty] Super beautiful model class female college student participates in the war! She panting in a hotel room that came secretly to her boyfriend exposed her outstanding beauty to the camera .. AV applicati

  • amateur censoredamateurbeautiful girlsirosiro-4542siro4542siro-4542
    • 2021-06-19
    130 min

    [DASD-877]Your Parents Went Away On Vacation: Your Lust For Your C***dhood Friend Unleashed, Creampie Sex Caught On Camera. Minami Hatsukawa

  • hatsukawa minami censoredcreampiesingle workDASDdasjo asagiriDASD-877DASD877dasd00877
    • 2021-06-20
    123 min

    [OIGS-039]Housewife Addicted To Bondage Play! While My Husband's Away, I'm My Ex-BF's S&M S***e. Kana Morizawa

  • kana morisawa kanako iioka censoredmature womanbdsmOIGSavs collector susubashisuiavscollector sOIGS-039OIGS039oigs00039
    • 2021-06-25
    179 min

    [MIAA-456]Married Woman Double Deep Throat Fucking Adulterous Trip Alice Otsu Akari Niimura

  • otsu alice akari shinmura censoredbig titsdeepthroatMIAAmoodyzkogoro kindaichieveryone s porn starMIAA-456MIAA456miaa00456
    • 2021-07-02
    212 min

    [HUNTB-047]Step-Sister With A Step-Brother Complex Wishes To Be Lovers For Just A Few Hours! "Step-Brother...I'm Sorry. I've Grown To Like You..." I Wake Up And She Is Kissing Me And Holding Me...

  • censoredcreampieblowjobHUNTBhuntervolvo nakanohhh groupHUNTB-047HUNTB047huntb00047
    • 2021-07-09
    148 min

    [MIAA-468]Sexually Frustrated Nipple Slut Does Nipple Play With Young Wife Who Can't Stop Staring At Her Breasts Through Her Thin Clothes Sakura Tsuji

  • sakura tsuji censoredcreampieslutMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-468MIAA468miaa00468
    • 2021-07-16
    81 min

    259LUXU-1452 Luxury Tv 1431 "i Want To Have Intense Sex …" A Neat And Graceful Beauty Is Re-appearing Because Of Its Popularity! Immediately After Being Touched By A Man, It Creates A Bewitching Atmosphere As If The Instinct Was Stimulat

  • amateur censoredamateurluxuluxu-1452luxu1452259luxu-1452
    • 2021-07-24
    240 min

    [HUSR-240]The Country With The Most Beautiful Women In The World! Special Collection Of The Ultimate Weapons From Russia, The Kingdom Of Beauties! Who Ever Knew Russia Had Such Amazing Women？!

  • isabel clark ibana censoredcreampiebig titsHUSRbig mocalbooker thustleHUSR-240HUSR24057husr00240
    • 2021-07-30
    66 min

    383REIW-086 Hime

  • amateur censoredcreampiebig titsreiwreiw-086reiw086383reiw-086
    • 2021-07-30
    98 min

    [EKW-072]Nipple Pleasure Connoisseur. Himari Kinoshita

  • himari kinoshita himari hanazawa censoredblowjobslutEKWwaap entertainmentk westcobraEKW-072EKW0722ekw00072
    • 2021-08-06
    197 min

    [MIDE-961]I Just Want To Be Fucked By Nozomi Ishihara In Our Private Home Until The Sun Rises.

  • ishihara hope censoredcreampiebig titsMIDEmoodyzsamoarimoodyz divaMIDE-961MIDE961mide00961
    • 2021-08-26
    49 min

    H4610 ki210826 Seiko Kuramoto 26years old

  • amateur uncensoredh4610
    • 2021-09-03
    120 min

    [JBD-273]The Female Doctor, A Beautiful Woman, Is Sorry She Made A House Call. Miki Maeshima

  • miki maejima censoredsingle workJBDattackerskanou hanahebi bakuJBD-273JBD273jbd00273
    • 2021-09-09
    104 min

    FC2PPV 2179701 Doll Half-Type 157 Cm 43 Kg Fair-Skinned Slender. "Is It Okay To Do Something Wrong With Her Teacher？"

  • amateur uncensoredfc2
    • 2021-10-02
    160 min

    [LULU-100]"If You Can"t Hold It In You Can Put It Inside Me!" I"m So Horny I"m About To Explode! Wife Addicted To Sex After Fucking Many Times Yuri Fukada

  • yuri fukada censoredcreampiebig titsLULUlunaticsvragmanLULU-100LULU100lulu00100
    • 2021-10-05
    61 min

    Caribbeancom 100521-001 The Continent Full Of Hot Girls, File.084 Kurumi Kokoro

  • kurumi kokoro uncensoredcreampiecaribbeancom
    • 2021-10-07
    88 min

    [REBD-594]Noeru Jumping Fairyland - Noeru Honda

  • honda noeru censoredsingle workREBDrebeccasawamura akiraREBD-594REBD594h-346rebd00594
    • 2021-10-07
    222 min

    [NHDTB-587]A Big Tits S********l In Uniform Gets Groped And Grabbed From Behind And Wiggles Her Ass On A Crowded Bus By A Titty Grabbing M****ter 14

  • censoredbig titsschoolgirlNHDTBnatural highjaken kodamaNHDTB-587NHDTB5871nhdtb00587
    • 2021-10-09
    95 min

    [HOKS-104]I Can"t Stand It! An Afternoon Of Pent-up Desire. Shiori, Age 24. Ai, Age 28. Yuzu, Age 21.

  • fukada yuuri nagase aizai censoredbig titsslutHOKSfa pro platinumogurokku kinzoufa proHOKS-104HOKS104
    • 2021-10-14
    63 min

    10musume 101421_01 Sex Is A Great Way To Relieve The Stress From Seeking Work OKAZAKIAYUMI

  • amateur uncensored10musume
    • 2021-10-16
    239 min

    [TIKB-124][Amazing Gal Hall Of Fame] Gals Really Are The Best! vol. 4

  • marin natsuki tsukasa nagano censoredcreampiebig titsTIKBchikichikiba gu mousozokuTIKB-124TIKB124tikb00124
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-30
    52 min

    FC2PPV 2389900 [Reading Notice] Teenage Active Students. The Moment Of Loss Of Virginity. "I Can’t Do It .. I’m Going Home Because I Don’t Need Money …" Her Life Ended With A Big Cry And A Large Amount Of Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-11-11
    59 min

    1Pondo 111121_001 Braless Neighbor In The Morning: Kanae Murakami

  • amateur uncensored1pondo
    • 2021-11-20
    82 min

    415LAS-041 Reira-San (Fujii Leila)

  • amateur censoredcreampiebig titslaslas-041las041415las-041
    • 2021-11-21
    21 min

    FC2PPV 2450005 Tall Young Wife Does Not Come To Repay, So After Collecting At Home, It Will Not Be Repaid Again, So It Is Open To The Public

  • amateur uncensoredfc2
    • 2021-12-12
    222 min

    [ERHT-010]Hot POV Voyeur Porn Is The Best 10

  • censoredERHTariseflea market ariseERHT-010ERHT010h-1577erht00010
    • 2021-12-17
    101 min

    428SUKE-101 [Cute Blow-Loving Beautiful Girl] Blow Smile Invincible I Want To Flirt From Morning Till Night! Actually, The Bar Clerk Professional Student Who Likes A Little Forcible Sex Is Weak In Alcohol, But When He Gets Drunk, He Really Wants To K

  • amateur censoredcreampiesquirtingsukesuke-101suke101428suke-101
    • 2021-12-18
    121 min

    [GVH-336]Father-in-law And Wife, Close Nakadashi Copulation, Shinon Mizutani

  • mizutani heart sound rio fujisaki censoredcreampiesingle workGVHglory questtakahashi chitsujiGVH-336GVH336gvh00336



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download