high vision shame prank jav




FC2MEYDMARAMILKCHRVBBANAWDRBDNACRAVSASTARSCAWDMIDVNATRFSDSSHMNGVHHNDAPODKBIATID

2020-10-24
146 min

[DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-11-01
    120 min

    [YAP-020]The Insane POV Master The Mature Woman Goddess Of Good Luck In A Mysterious POV Journey vol. 18

  • censoredamateurmature womanYAPflowers and honeyandaikichicheap professionalYAP-020YAP020yap00020
    • 2020-11-07
    125 min

    [SORA-276]A Personality-Altering Brainwashing Fuck Due To My Father's Indiscretions, I Was Lowered To The Lowest Caste Of School Society, But I've Put My Teacher Under A Spell And Now I'm Enjoying Brainwashing Atmospheric-Busting Sex! Not

  • nozomi haneda censoredslutsingle workSORAyama to sorayosukeSORA-276SORA276sora00276
    • 2020-11-14
    58 min

    Pacopacomama 111420_384 Reika Yoshimi

  • reika yoshimi uncensoredcreampieblowjobpacopacomama
    • 2020-11-28
    80 min

    [SD-009]Porn Star Feast -HYPER HARD PORN GOURMET REPORT- Miku Abeno

  • censoredcreampieamateurSDplumbaron reikokuSD-009SD009h-113sd00009
    • 2020-12-12
    67 min

    FC2PPV 1604501 ★ First shot amateur ☆ Erotic BODY trained with basketball ♥ Active JD Yukimaru-chan 22 years old ☆ Erotic BODY with outstanding sensitivity ♥ Massive squirting squirting to blame electric massager ] * Benefits

  • amateur uncensoredfc2
    • 2020-12-16
    62 min

    374SHOW-036 Mugi

  • amateur censoredamateurshowshow-036show036374show-036
    • 2020-12-17
    149 min

    [PPPD-894]Creampie Soapland Brothel Three-Way - Flanked On Both Sides By Busty Sluts Who'll Drain Your Balls Dry With Unlimited Orgasms

  • marin natsuki manami oura censoredbig titsPPPDoppaiPPPD-894PPPD894pppd00894
    • 2020-12-19
    48 min

    398KAG-068 The frustrated body of a beautiful witch who still shines beyond the forties is out of control! !! A neat wife with an older husband is slammed with a big dick and a ceilingless gachiiki barrage ww

  • amateur censoredcreampiesquirtingkagkag-068kag068398kag-068
    • 2020-12-25
    482 min

    [IBW-808]"No More, Please..." Stepdaughters Ravished Over And Over By Their Stepdads - Footage Compilation 2 Discs, 8 Hours

  • amateur censoredIBWi b worksIBW-808IBW808
    • 2021-01-01
    129 min

    [PKPD-126]Sugar Daddy Dating - 18-Year-Old Willing To Take Creampies - Guaranteed To Get Wet Mona Amemiya

  • amemiya mona censoredcreampieschoolgirlPKPDfuck group and fun friends daydreamersPKPD-126PKPD126pkpd00126
    • 2021-01-22
    129 min

    [MBM-263]A Maid In Peril The Popular Girl At The Cafe She Was Tied Up By An Evil Customer And Fucked To Oblivion

  • censoredcosplayMBMprestigejanhirombmMBM-263MBM263118mbm00263
    • 2021-01-29
    50 min

    FC2PPV 1659821 [No] Spree a teenage girl with an old man’s cock! Inject sperm into the mouth and pussy respectively! It’s Eloy without a bottom, Aya-chan! The best meat urinal! !! 【selfie】

  • amateur uncensoredfc2
    • 2021-01-30
    87 min

    300MAAN-621 [SSS class celebrity beauty x limit Iki barrage x vaginal cum shot 3 barrage] God erotic celebrity beauty with big breasts, nice ass, beautiful legs 3B appeared! Lick and suck while feeling! Pleasure greedy blowjob! Pursuit demon Ikase wi

  • amateur censoredcreampiebig titsmaanmaan-621maan621300maan-621
    • 2021-01-30
    148 min

    [WAAA-028]My Girlfriend Went On A Company Trip And They Played Dirty Party Games And She Ended Up Being Fucked All Night Long By All Her Coworkers - Tsubomi

  • bud censoredcreampiedeepthroatWAAAwanz factorywanzWAAA-028WAAA028waaa00028
    • 2021-02-16
    195 min

    [STARS-339]This Girl Is A Wolf (A Horny Slut) In Sheep's Clothing (She's Pretending To Be Neat And Clean)! An SODstar Kaede Hiiragi Her Adult Video Debut

  • hiiragi kaede censoredbeautiful girlsingle workSTARSsod createanzosod starSTARS-339STARS3391stars00339
    • 2021-02-19
    128 min

    [SORA-296]A Serial Infidelity-Committing Wife A Miraculous 45-Year-Old Beautiful Bewitching Bitch Who Is Still In The Game, Cumming Down To Bless Us All! She's Forgetting All About Her Husband And Going On A 2-Day, 1-Night Adultery Trip With Her

  • censoredSORAyama to sorahimu lockSORA-296SORA296sora00296
    • 2021-03-05
    31 min

    359TYVM-136 Thirty legs beautiful wife de powerful portio cum sex! !!

  • amateur censoredcreampiebig titstyvmtyvm-136tyvm136359tyvm-136
    • 2021-03-07
    243 min

    [MLSM-040]S-class Beautiful Mature Woman BEST Yui Hatano 4 Hours Slender Madonna With Big Tits

  • yui hatano censoredcreampiebig titsMLSMmellow moonMLSM-040MLSM040mlsm00040
    • 2021-03-09
    81 min

    300NTK-532 Sakaike Meat Forest 4P Echi Echi Unmanned piston at the demon cowgirl of a carnivorous gal! !! Simultaneous insertion of raw chin in the scene with W Blow from cunnilingus only in the gal juice due to the ruckus of drinking and rubbing in

  • maxjdh censoredcreampieamateurntkntk-532ntk532300ntk-532
    • 2021-03-12
    74 min

    374SHOW-049 Kaede

  • amateur censoredamateurshowshow-049show049374show-049
    • 2021-03-23
    59 min

    H0930 ki210323 Risa Tamai 31years old

  • amateur uncensoredh0930
    • 2021-03-25
    93 min

    [OKS-108]Slippery, Wet, Shining And Skin-Tight - Incredible School Swimsuit Sex - Enjoy Adorable Girls In Swimsuits! Hidden Camera Voyeur Footage Close-Ups Of The Change Room Include Big Tits, Shaved Pussy, Snatch, And Armpits, Plus Lotion Soapland P

  • hope light censoredschoolgirlbeautiful girlOKSdaddy s private photosgoddess in a school swimsuitOKS-108OKS1081oks00108
    • 2021-03-26
    124 min

    [CMD-032]Temptation Beauty Salon - Mao Watanabe

  • mao watanabe censoredblowjobslutCMDdream ticketCMD-032CMD03224cmd00032
    • 2021-05-07
    161 min

    [MIST-335]Fucking While Ovulating! A Brothel Where You Can Get Girls Pregnant 28 June Lovejoy

  • june lovejoy censoredcreampiecosplayMISTmr michirusaitaMIST-335MIST3351mist00335
    • 2021-05-14
    118 min

    [SSIS-073]A Terrible Trip To Hot Springs Where I Pretended To Feel Good When I Was Fucked By This Older Guy I Hated - Mizuai Yamazaki

  • mizuyama yamazaki censoredbeautiful girlsingle workSSISs1 no 1 styleSSIS-073SSIS073ssis00073
    • 2021-06-12
    90 min

    300NTK-586 Big Breasts Echi Echi H Cup But Gachi Beautiful Girl’s Soft Body God Style Gravure Pleasure Fallen Video! !! Punipuni’s world’s largest fir tree with huge breasts is called erotic instruction, but it is caressed and horny! ？

  • amateur censoredcreampiebig titsntkntk-586ntk586300ntk-586
    • 2021-07-03
    97 min

    [VENX-053]She Can't Live Without Her Stepson Anymore... 50 Orgasms Push This Horny Stepmom To Her Upper Limit With Creampie Sex Yuna Kitano

  • yuna kitano censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-053VENX053venx00053
    • 2021-07-09
    162 min

    [IPX-686]In a Room on a Business Trip, Fresh Face Female Employee is Fucked Several Times All Night Long by a Superior Boss. Aroused to Come 8 Times, an Unequaled Cockold Sex Video. Ema Futaba

  • futaba emma censoredbig titsblowjobIPXidea pocketbungo maedadishIPX-686IPX686ipx00686
    • 2021-07-17
    61 min

    519MAZOF-007 [Browsing Self-Responsibility] Up-And-Coming Female Calligrapher 29 Years Old [Fusion Of Calligraphy And Power Elegant] Masochist Woman Who Exposes Her Boobs Boobs And Cum Shot [Personal Shooting] Karen Aihara

  • amateur censoredcreampiebig titsmazofmazof-007mazof007519mazof-007
    • 2021-07-18
    127 min

    [GENM-085]Temptation Into SEX With Extreme Piston Action! The Man She Seduced Can Seriously Thrust His Hips - Mari Takasugi

  • mari takasugi censoredsingle workGENMgenekig 3GENM-085GENM085genm00085
    • 2021-07-22
    122 min

    [FSDSS-256]FALENO Members Only This Soapland Provides National Treasure-Class Service Minamo Nagase

  • minase nagase censoredbig titsblowjobFSDSSfalenoboomer 44faleno starFSDSS-256FSDSS2561fsdss00256
    • 2021-07-30
    140 min

    [RBK-020]Asking For A Girl At A Dating Club And A Usually Serious And Quiet Girl Who Is A New University Graduate Arrives So I Give Her A Good Fucking. Natsu Tojo

  • natsu tojo censoredbeautiful girlsingle workRBKattackersjo styleryuu bakuRBK-020RBK020rbk00020
    • 2021-07-31
    124 min

    [PKPD-159]Dating An 18 Year Old Girl Named Himari Who Will Let Me Creampie Her, She"s Almost A Virgin, Super Masochistic, And In The 1st Year, I Can Creampie Her All I Want - Himari Ayase

  • himari ayase censoredcreampiebeautiful girlPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-159PKPD159pkpd00159
    • 2021-08-01
    125 min

    [NACR-449]噂の引っ越し業者はノーブラでプリプリお尻のピタパンお姉さん 天上みさ

  • misa tenjo censoredbig titsblowjobNACRplanet plushimurokkushichi ku ryuuNACR-449NACR449h-237nacr00449
    • 2021-08-11
    96 min

    [ETQR-269][Daydream POV] Temptation Of, And Sex With, A Slut And Beautiful Girl, Marina Saitou

  • marina saito censoredcreampieuniformETQRerotic timeETQR-269ETQR269etqr00269
    • 2021-08-12
    135 min

    [HBAD-592]I Never Though My My Colossal Tits Girlfriend Would Cheat With My Dad"s Big Cock, Yukino Nagisa

  • yukino nagi censoredbig titssingle workHBADhibinorokutanzono seishibabeHBAD-592HBAD5921hbad00592
    • 2021-08-13
    120 min

    [SSIS-159]Extreme Orgasming 139 Times! 5120 Spasms! 2100 cc Of Squirt Juice! A Slender 152cm Beautiful Girl"s Eros Awakens. The First Great Spasm Special. Ren Hirose

  • hirose lotus censoredsquirtingbeautiful girlSSISs1 no 1 stylehasami kukaSSIS-159SSIS159ssis00159
    • 2021-08-21
    61 min

    1Pondo 082121_001 I Will Teach You How To Handle The Cock In Practice! Kurumi Kokoro

  • amateur uncensored1pondo
    • 2021-08-28
    50 min

    C0930 hitozuma1361 Saori Koso 26years old

  • amateur uncensoredc0930
    • 2021-08-31
    134 min

    [SDAB-195]Fucked By Three S*****ts During Summer Vacation [4K Video]

  • kuruki rei momose asuka censoredcreampiebeautiful girlSDABsod createyazawa reshi buseishun jidaiSDAB-195SDAB195
    • 2021-09-09
    104 min

    [GS-402]Step-cousin Comes To The City To Start College, Her Body Is More Mature Now And She"s Staying From The Afternoon Until Late For A Night Visit!! After A Long Tour Around The City, She Comes Back To My Room In Her Underwear For A Midday Nap

  • censoredschoolgirlGSsosoru x garconred ballGS-402GS402h-101gs00402
    • 2021-09-17
    81 min

    [sqb-119]えま(20)

  • amateur censoredbig titsamateursqbsqb-119sqb119sqb-119
    • 2021-10-02
    66 min

    SIRO-4651 [First Shot] [G Cup X Pink Nipple] [Best Fucking Service] An Erotic-Faced Yakiniku Restaurant Clerk Who Creates A Mature Atmosphere. The Erotic Body Carrying Ss Class Big Breasts Is Moved, And The Cock Has Been Climaxing Many Times In A Lon

  • amateur censoredbig titsamateursirosiro-4651siro4651siro-4651
    • 2021-10-08
    124 min

    [NKKD-228]Fondling Sweaty And Sopping Wet See-Thru Colossal Tits NTR A Colossal Tits Housewife Gets Fucked To Dripping Wet, Transparently Sweaty Ecstasy By The Plumber Hana Haruna

  • haruna hana censoredmature womansingle workNKKDjet eizougroupNKKD-228NKKD228nkkd00228
    • 2021-10-13
    59 min

    541AKYB-019 Hana (26) Plenty Of Hentai Big Tits ○ ♪

  • amateur censoredcreampieamateurakybakyb-019akyb019541akyb-019
    • 2021-10-19
    91 min

    261ARA-511 [Miss Campus] [Mote Beauty] Karen-Chan Is Here! "I’m Curious About Sex ♪ I Came To Compare Amateurs And Professionals" There Are Quite A Few Brothers (Saffle) At The University ♪ Over 100 Experienced People! A Cute Beauty With

  • amateur censoredbig titsamateuraraara-511ara511261ara-511
    • 2021-10-23
    97 min

    FC2PPV 2367108 [Individual Shooting 59] Complete Appearance Prefectural K ③ Super Loli Suji Pie Bread Cleaning Fellatio After Re-Injection Many Times From Continuous Vaginal Cum Shot

  • amateur uncensoredfc2



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download