high vision planning kiss javcensored censored




FC2RBDSSNINACRSSISSANNNPJAUKGDASDPPPDMILKSQTEFSDSSWAAAHMNMIDVKBIGMEMNATRNGODBBAN

2020-09-26
39 min

FC2PPV 1515134 [Personal shooting] No.019 Yuri-chan ★ Slender and cute female college student. The nasty hip swing from awkward blowjob is exciting ★ [Complete appearance]

  • amateur uncensoredfc2
    • 2020-09-27
    168 min

    [YAKO-016]A Legendary Nampa Pickup Artist Presents The 3 Best Beautiful Girl Babes He's Ever Fucked In His Life, Now For The First Time On DVD

  • censoredcreampiebig titsYAKOmercuryshinjuku undergroundYAKO-016YAKO016h-1133yako00016
    • 2020-10-02
    130 min

    [CHN-191]New: We Lend Out Amateur Girls. 92 (Pseudonyms) Hinano Kashii (Community College S*****t) 20 Years Old.

  • kashii hinano censoredanalbig titsCHNprestigemanhattan kimurataiCHN-191CHN191118chn00191
    • 2020-10-09
    86 min

    [FTHT-004](This Tokushima-Bred Babe Is Enjoying Awa Dance Orgasms!) The Naruto Channel! Her Womb Is Throbbing! Her Pussy Is Writhing! She's Squirting With Insane Lust! This Big Dick Is Plunging Deep Down Her Throat! Her Drool Is Foaming In Gliste

  • censoredcreampiebeautiful girlFTHTfalenodavielfalenotubeFTHT-004FTHT0041ftht00004
    • 2020-10-10
    61 min

    1Pondo 101020_001 Model Collection: Nozomi Nakase

  • amateur uncensored1pondo
    • 2020-10-12
    38 min

    475SKCK-001 Kyoko 01

  • amateur censoredanalamateurskckskck-001skck001475skck-001
    • 2020-10-16
    125 min

    [AEG-008]Black Giant Cock Destruction Incoming - Mari Kagami

  • mari kaga censoredcreampiedeepthroatAEGprestigehideki hormonaegean prestigeAEG-008AEG008118aeg00008
    • 2020-10-16
    109 min

    [DOCP-253]Daddy Orgy Mask JD Crazy Sex - Creampie Madness

  • censoredcreampiesquirtingDOCPprestigedoc premiumDOCP-253DOCP253118docp00253
    • 2020-10-18
    46 min

    279UTSU-455 Iorisan

  • amateur censoredmarried womanamateurutsuutsu-455utsu455279utsu-455
    • 2020-11-13
    151 min

    [MIDE-849]Gaping Wide Deep Throat Face Fucks - Slut Tied Up And Skewered By Cock To Incredible Creampie Orgasms Tsubomi

  • bud censoredcreampiedeepthroatMIDEmoodyzsuisei akaimoodyz divaMIDE-849MIDE849mide00849
    • 2020-11-19
    95 min

    [BGSD-412]Hidden Beauties Revolution Suzu

  • censoredBGSDbagussawamura rikiBGSD-412BGSD412h-305bgsd00412
    • 2020-11-20
    93 min

    [KYUN-001](For Streaming Editions) # Heart Pounding Thrills 001/Hina/22 Years Old/College S*****t

  • censoredcreampieamateurKYUNprestigekyunKYUN-001KYUN001118kyun00001
    • 2020-12-10
    133 min

    [NEO-748]Shameful Armpit Play - Rin Hatsumi

  • hatsumi rin censoredsquirtingsingle workNEOradixshio sakurabaneo paradoxNEO-748NEO748433neo00748
    • 2020-12-17
    61 min

    Caribbeancom 121720-001 The Story Of Luxury Spa Lady, Vol.86 Miki Aimoto

  • miki aimoto uncensoredcreampiehandjobcaribbeancom
    • 2020-12-24
    170 min

    [NHDTB-473]She Got Her Cunt Pumped With Furious Piston-Pounding Strokes, And She Came While Overflowing With Pussy Juices And Giving Deep Throat Blowjobs! Sensual Woman Who Experience F***eful Perversion Awakenings

  • censoredblowjobNHDTBnatural highvanilla sakuraiNHDTB-473NHDTB4731nhdtb00473
    • 2020-12-27
    59 min

    HEYZO 2425 Horny Married Woman Wants To Have Sex — – Ryu Enami

  • ryu enami uncensoredcreampieheyzo
    • 2020-12-31
    120 min

    [NKKD-190]This Couple Dreamed Of Living In The Country... The Husband Never Imagined Hung Farmers Would Be Plowing His Wife Miho Tono

  • miho tsuno censoredmature womansingle workNKKDjet eizomanji groupNKKD-190NKKD190nkkd00190
    • 2021-01-13
    39 min

    230ORE-747 Mako-san

  • amateur censoredcreampieamateuroreore-747ore747ore-747
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-22
    51 min

    [oretd-841]MOMOTA

  • amateur censoredcreampieuniformoretdoretd-841oretd841oretd-841
    • 2021-01-29
    200 min

    [ABW-051]Aesthetics Of A Facial 13 - Creamy Cum Dripping From The Faces Of Hot Babes! Rumina Yuki

  • yuki rumina censoredcosplaysingle workABWprestigeshimikkiabsolutely wonderfulABW-051ABW051118abw00051
    • 2021-02-06
    118 min

    [ADN-290]Licking Hard: Father In Law's Desire 7 - Shihori Kotoi

  • shiori kotoi censoredsingle workdramaADNattackersnaotootona no dramaADN-290ADN290adn00290
    • 2021-02-07
    139 min

    [PKPD-129]Compensation Creampie Dating, Age 18, Colossal Tits, Cheerful Cumming Slut Hana Himesaki

  • himesaki hana censoredcreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-129PKPD129pkpd00129
    • 2021-02-12
    147 min

    [GNAB-047]JKs Who Wear Black Stockings Only! When We Told These Ladies That They Would Win Big Cash Money Prizes If They Could Identify The Remote Control That Was Controlling The Remote-Controlled Vibrator Tickling Their Pussies ...

  • censoredschoolgirlGNABprestigebang prestigeGNAB-047GNAB047118gnab00047
    • 2021-03-06
    244 min

    [DVDMS-642]This Old Lady From The Neighborhood Had Such A Tight Ass, I Just Had To Slam By Big Cock In For A Quickie! 4 When I Pumped Her Hard And Teased Her With Pull Out Sex, While Sweet-Talking Her Like A Handsome Man Should And Thrust My Cock Int

  • censoredcreampiemarried womanDVDMSdeepsnagases wingdeep sDVDMS-642DVDMS642dvdms00642
    • 2021-03-07
    53 min

    HEYZO 2474 Nonstop Sexual Orgasm – Akari Mizuki

  • akari mizuki uncensoredcreampiehandjobheyzo
    • 2021-03-24
    55 min

    444KING-031 Rina (19)

  • amateur censoredcreampiebig titskingking-031king031444king-031
    • 2021-03-27
    123 min

    [PAKO-033]A Beautiful Mature Woman With Huge Tits Who Is Feeling Frisky Now That Her Divorce Is Completed - 33 Years Old

  • censoredbig titsamateurPAKOmercuryold lady fucking cafeteriaPAKO-033PAKO033h-1133pako00033
    • 2021-03-27
    160 min

    [LULU-063]While My Parents Were Away On A Trip My Adoring Step Sister (With Amazing Blowjob Technique) Sucked Me Off Morning And Night Natsuna Hayama

  • hayama natsuna censoredcreampiebig titsLULUlunaticsvagmanLULU-063LULU063lulu00063
    • 2021-04-01
    148 min

    [GOJU-179]No Warning!! A Fifty-Something Mature Woman Who Came To Work A Blowjob Is Suddenly Providing Opportunities For Oral Ejaculation! 2

  • censoredamateurblowjobGOJUfifty somethingGOJU-179GOJU179h-1165goju00179
    • 2021-04-02
    67 min

    [393OTIM-068]【妄想主観】憧れのバイト先の制服娘を催淫洗脳 東條なつ

  • amateur censoredcreampieuniformotimotim-068otim068393otim-068
    • 2021-04-09
    160 min

    [REAL-766]Young Wife With Big Tits Made To Breed With 20 Continuous Creampies Akari Niimura

  • akari shinmura censoredcreampiebig titsREALreal workskannana dainanareal real worksREAL-766REAL766real00766
    • 2021-04-28
    41 min

    517MQXT-002 A Sober Girl Who Spree Alive While Incontinence After Being Aphrodisiac

  • amateur censoredschoolgirlamateurmqxtmqxt-002mqxt002517mqxt-002
    • 2021-05-01
    115 min

    [RBK-012]The Tragic Super High-Class Raw Sex Soapland Lady Michiru Kyujo

  • kujo michiru censoredsingle workRBKattackerseitaro hagaeryupakuRBK-012RBK012rbk00012
    • 2021-05-07
    125 min

    [FSDSS-220]My Dick Got Impossibly Hard As I Watched My Beloved Girlfriend With Colossal Tits Get Brainwashed And Fucked By My Sadistic Boss. Sara Kamiki

  • sara kamiki censoredbig titssingle workFSDSSfalenokicchomufaleno starFSDSS-220FSDSS2201fsdss00220
    • 2021-05-13
    95 min

    [MHAR-002](The Men's Massage Parlor Everybody's Talking About) Mature Woman Masseuse's Secret Raw Creampie SEX Options 2

  • censoredcreampieamateurMHARmilf laboMHAR-002MHAR002h-1160mhar00002
    • 2021-05-28
    240 min

    [CLUB-640]Rejuvenating Massage With Married Women You Can Fuck 28 Hidden Footage Of Negotiating For Raw Sex

  • censoredcreampiebig titsCLUBhentai gentleman clubCLUB-640CLUB640club00640
    • 2021-06-26
    116 min

    [CHCH-008]Step Grandmother And Step Grandson HH

  • censoredbig titsmature womanCHCHmilk and moms emmanuellemilk and momsCHCH-008CHCH008chch00008
    • 2021-07-10
    245 min

    [BAZE-003]Extra Help at Lunch Time, Secret from the Company Beautiful Office Lady Earns Money for SEX and 4 Hours of Creampies. 03

  • censoredcreampiebig titsBAZEbazookatetBAZE-003BAZE003baze00003
    • 2021-08-12
    121 min

    [FSDSS-280]I Wanted To Be A Vocalist, But One Day I Noticed My Flute Skills Were Amazing, Momo Honda

  • honda peach censoredsquirtingsingle workFSDSSfalenoboomer 44faleno starFSDSS-280FSDSS2801fsdss00280
    • 2021-09-25
    240 min

    [HUSR-243]All Blonde! And They"re All Hotties With Crazy Measurements! Most Amazing Raw Fucking With East Europe SSS Rank Hotties! 10 Women 4 Hours

  • candy tee vibiana censoredbig titsamateurHUSRbig mocalbooker thustleHUSR-243HUSR24357husr00243
    • 2021-10-02
    59 min

    HEYZO 2622 Sleep With My Boyfriend! -NTR Request From My Best Friend- – Shiori Yamagishi

  • amateur uncensoredcreampiehandjobheyzo
    • 2021-10-04
    73 min

    542MGBJ-002 Kana 2

  • amateur censoredamateurmgbjmgbj-002mgbj002542mgbj-002
    • 2021-10-28
    112 min

    [AARM-030]Mahiro Ichiki, An Antisocial Reclusive Novelist Without A Boyfriend, Uses Her Slender Beautiful Legs To Charm And Pleasure Men To Get Material For Her Erotic Novel.

  • mahiro ichiki censoredsingle workAARMaroma kikakuhamu oujiaromaAARM-030AARM030aarm00030
    • 2021-10-29
    240 min

    [MIZD-254]Women Who Love Sucking Dick Want To Keep Going During SEX! BEST Orgy Blowjob

  • nanasawa mia nakayama fumika censoredblowjobMIZDmoody smoodyz bestMIZD-254MIZD254mizd00254
    • 2021-11-02
    63 min

    200GANA-2547 In The Spear Room Of The Nampa Master Of Hyakusen Hakusen, Bring In Sex Hidden Camera 225 Bring A Friendly Half Daughter Into The Room! Cum With A Sensitive And Intense Body! Rec Icharab Sex With A Hidden Camera! !! (Ran Sakita)

  • amateur censoredamateurganagana-2547gana2547200gana-2547
    • 2021-11-05
    120 min

    [SSIS-236]Tricked By Sexy Costume Non-Nude Erotica And Gang-Fucked By Stuff Non-nude Erotica Wearing Only Cum Youthful Model Kozue Kujita

  • kozue fujita censoredsquirtingsingle workSSISs1 no 1 stylekc takedaSSIS-236SSIS236ssis00236
    • 2021-11-11
    166 min

    [NHDTB-600]A Female S*****t Sweating In A Closed Room Who Starts Feeling Horny Even Though She Hates Being Licked

  • censoredsquirtingschoolgirlNHDTBnatural highsymmetry nakataNHDTB-600NHDTB6001nhdtb00600



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download