high vision jav big tits titty fuck miss hippopotamus




FC2FSDSSONEZAWDNNPJNACRAUKSHODVBBANHNDJUFEATIDSPRDMEYDDASDSQTENATRADNSDABABWSSNI

2020-10-11
140 min

[MIBB-005]Black Pantyhose Honor S*****t: Erika Aimi

  • rumi tadami censoredschoolgirlsingle workMIBBmiluMIBB-005MIBB005mibb00005
    • 2020-10-27
    129 min

    [GONE-018]Mature Woman With Sexy, Sultry Brown Hair And Tingling, Tanned Skin Explore The Boundaries Of Erotic Potential With A Woman Over 35 Ayaka Muto

  • ayaka muto censoredmature womansingle workGONEmercurybirdman teppeian erotic tanned elder sisterGONE-018GONE018h-1133gone00018
    • 2020-11-03
    145 min

    [SDMM-073]Sleeveless Girls Only "Do You Shave Your Pits？" The First Armpit Fucks Of Their Lives - All 6 Girls Get Bukkake, 2 Go All The Way!

  • censoredamateurhandjobSDMMsod createanzomagic mirrorSDMM-073SDMM0731sdmm00073
    • 2020-11-12
    60 min

    [tkwa-129]そら

  • amateur censoredcreampieamateurtkwatkwa-129tkwa129tkwa-129
    • 2020-11-20
    42 min

    FRYD-015 Niina

  • amateur censoredbig titsamateurfrydfryd-015fryd015fryd-015
    • 2020-11-28
    28 min

    FC2PPV 1587359 A 19-year-old Starbucks clerk. Gonzo (tend Leak)

  • amateur uncensoredfc2
    • 2020-12-11
    481 min

    [PPT-103]Maria Aine 8-Hour BEST PRESTIGE PREMIUM TREASURE Vol. 06 - Enjoy "Maria Aine's" Entire Career Trajectory With All 6 Of Her Films + Unreleased Footage In This Timeless Collector's Edition!

  • maria aine censoredcreampiePPTprestigeprestige premium treasurePPT-103PPT103118ppt00103
    • 2021-01-08
    47 min

    FC2PPV 1637514 * Uncensored * Appearance! !! !! It’s a mass production of thanks for the service SEX of the former J ○ L flight attendant ♡ There is a luxury purchaser privilege!

  • amateur uncensoredfc2
    • 2021-01-16
    83 min

    C0930 ki210117 Mayu Aizawa 29years old

  • amateur uncensoredc0930
    • 2021-01-16
    47 min

    FC2PPV 1647598 * Uncensored * First shot * Early termination fear ☆ Active certain popular underground idol N-chan (21) live video flow 〇 out! !! Private Creampie SEX With Estheticians! There are luxury purchaser benefits

  • amateur uncensoredfc2
    • 2021-01-23
    134 min

    [JKSR-478](Leaked Pictures) A Sch**lgirl Gets Fucked During Team Training Camp Sex/Night Visits/Creeping Threesomes/Baths/Peeping While Changing... And Plenty Of Other Illicit Videos Full Videos 133 Minutes

  • censoredcreampieschoolgirlJKSRbig morkalprink junkyJKSR-478JKSR47857jksr00478
    • 2021-01-24
    50 min

    285ENDX-326 The young lady JD had a neat face and a neat face! Even though I’m confused by my first double blow job, I lift my hips and spree! Goose bumps too much!

  • amateur censoredcreampiesquirtingendxendx-326endx326285endx-326
    • 2021-01-25
    41 min

    IDJS-038 Ayumu

  • amateur censoredcreampiebig titsidjsidjs-038idjs038idjs-038
    • 2021-02-06
    61 min

    10musume 020621_01 Semen-covered face is vulgar and super obscene

  • amateur uncensored10musume
    • 2021-02-08
    33 min

    FC2PPV 1678024 [Active CA, 7th] Miyo-san ② ♡ 24 years old ♡ Blindfolded ♡ Limited time offer

  • amateur uncensoredfc2
    • 2021-02-12
    196 min

    [ABW-054]Mine And Remu's Fantasy World Sex Life ACT. 07 - Breaking Through All Erotic Borders With The Strongest Sexy Armor!!! Remu Suzumori

  • suzumori remu censoredbig titssquirtingABWprestigemichiru sanabsolutely wonderfulABW-054ABW054118abw00054
    • 2021-02-13
    139 min

    [CESD-977]Married Amateur's First Anal Fuck! Iori's First-Ever Two-Hole Fuck In Her Forties Drives Her Wild With Ecstasy!

  • censoredamateurmature womanCESDcelebrity friendsCESD-977CESD977cesd00977
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-27
    62 min

    200GANA-2438 In the spear room of the Nampa teacher of 100 battles, bring in SEX hidden shooting 191 Bring your cute erotic sister to the spear room and enjoy sweet sex like a lover! Carefully caress and supple body, quivering and feeling!

  • amateur censoredamateurganagana-2438gana2438200gana-2438
    • 2021-03-03
    46 min

    362SCOH-043 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Junko Enoshima]

  • amateur censoredbig titsuniformscohscoh-043scoh043362scoh-043
    • 2021-03-15
    63 min

    328HMDN-345 [W Demon Cock x Married Woman Orgy 3P] Day Face Dirty Wife Yuri (pseudonym) 26 years old I’m cheating because I’m not satisfied. Deep kiss by drinking a whole cock with a pussy that wants sperm other than her husband. Fertilizat

  • amateur censoredcreampiemarried womanhmdnhmdn-345hmdn345328hmdn-345
    • 2021-03-17
    46 min

    [031721-001][VR] Meet a Soapland Angel

  • airi mikumo uncensoredcreampiecaribbeancom
    • 2021-03-18
    120 min

    [PPPD-910]After The Company Party, I Missed The Last Train Home, So I Ended Up Crashing At My Colossal Tits Lady Boss' Home, And Then She Said ... "Fondle My Tits!!" And Then She Pushed Me Onto The Floor And Creampie Fucked Me Until The B

  • hitomi censoredcreampiebig titsPPPDoppaiPPPD-910PPPD910pppd00910
    • 2021-03-18
    123 min

    [GS-2011]True Stories: All In The Family Fucks (48)

  • sakashita maki censoredGSgosGS-2011GS2011
    • 2021-03-19
    120 min

    [KSBJ-126]A Smart Mom's Spartan Sex Training Yu Kawakami

  • yu kawakami morino morino censoredblowjobmature womanKSBJksb kikaku emmanuellebito sakuraKSBJ-126KSBJ126ksbj00126
    • 2021-03-25
    116 min

    [GS-381]I Thought I Finally Had Something On The New Girl At Work... But She Ended Up Having Me By The Balls Instead! She's Always Skipping Work To Play On Her Phone In A Miniskirt So Short You Can See Her Panties. When I Tried To Spy On Her, She

  • censoredschoolgirlamateurGSsosoru x garconred ballGS-381GS381h-101gs00381
    • 2021-04-05
    33 min

    FC2PPV 1755882 [Personal shooting, vaginal cum shot, 300p off for a limited time] A 30-year-old married woman who is jointly owned

  • amateur uncensoredfc2
    • 2021-04-20
    59 min

    492JCHA-006 JK Fresh Erotic Oil Massa Treatment 3

  • amateur censoreduniformschoolgirljchajcha-006jcha006492jcha-006
    • 2021-04-24
    91 min

    383REIW-057 Ranka

  • amateur censoredcreampieamateurreiwreiw-057reiw057383reiw-057
    • 2021-05-14
    124 min

    [MVSD-462]This Exchange S*****t Is A Blowjob Idol Improper Morals Lead To Improper Sexual Organs! A Real-Life Idol Shows Off Her Blowjob SK**ls To Bring Order To Our School Hana

  • white peach censoredcreampieschoolgirlMVSDm s video groupMVSD-462MVSD462mvsd00462
    • 2021-05-25
    69 min

    [052521_001]おもてなし ～男のムラムラゾーンを知り尽くした女たち～

  • amateur uncensored1pondo
    • 2021-05-29
    35 min

    FC2PPV 1841563 [Business trip orgy] Local advertising agency Event planning department OL 2 people x Chararyman 3 people ② [High image quality]

  • amateur uncensoredfc2
    • 2021-06-10
    119 min

    [HBAD-585]A Mother Was Made To Have Sex With Her Son's Friends To Relieve Their Sexual Desire And Ended Up Being Covered In Semen Ayano Fuji

  • ayano kato censoredmomsingle workHBADhibinodragon nishikawababeHBAD-585HBAD5851hbad00585
    • 2021-06-17
    121 min

    [MKON-055]My C***dhood Friend Who Has A Stalker Asked Me To Be Her Bodyguard When She's Leaving School Natsu Tojo

  • natsu tojo censoredcreampieschoolgirlMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-055MKON055mkon00055
    • 2021-06-20
    129 min

    [CEMD-028]Pushed To The Upper Limit Of Nipple Pleasure! Sensitive Teats Teased Relentlessly! Mao Watanabe

  • mao watanabe censoredcreampieblowjobCEMDceleb no tomoCEMD-028CEMD028cemd00028
    • 2021-06-20
    239 min

    [OKAX-748]"No... Stop..." Pranks On My Younger Stepsister 240 Minutes

  • censoredsisterOKAXk m producedick mandokuokazuOKAX-748OKAX748okax00748
    • 2021-06-25
    83 min

    383REIW-076 Mina

  • amateur censoredbig titsamateurreiwreiw-076reiw076383reiw-076
    • 2021-06-26
    47 min

    C0930 ki210627 Kayoko Yuge 31years old

  • amateur uncensoredc0930
    • 2021-07-01
    152 min

    [BDSM-076]Discipline By Bondage Miaya Shio

  • aya shiomi censoredsingle workBDSMtaitotakuanmaniacBDSM-076BDSM076h-1096bdsm00076
    • 2021-07-02
    129 min

    [RBK-017]Beautiful Hostess: Rough Anal Reception Mako Oda

  • oda mako censoredanalsingle workRBKattackerskaoru okuzonoryupakuRBK-017RBK017rbk00017
    • 2021-07-17
    190 min

    [JUL-647]She Turns Into A Completely Different Person With A Cock Inside Her. 34 Years Old, Married, And Cock-Crazed Saori Nagashima Makes Her AV Debut.

  • nagashima saori censoredmarried womanmature womanJULmadonnamamezawa mametaroJUL-647JUL647jul00647
    • 2021-08-13
    183 min

    [HUNTB-078]My Step-sister Exposed Her Ass To Me And It Was Too Erotic! I Fucked Her And Came Inside Her Multiple Times!

  • censoredcreampieschoolgirlHUNTBhunterkonnyaku kannohhh groupHUNTB-078HUNTB078huntb00078
    • 2021-08-14
    72 min

    FC2PPV 2020512 * A Girl Student Who Has Run Away From Home. Please Take A Look.

  • amateur uncensoredfc2
    • 2021-08-21
    181 min

    [MADV-511]I Haven"t Seen My Boyfriend In So Long... I"m Sexless And Frustrated! Meeting A Horny, Nympho Girl Offline For The First Time!

  • miki sanada miki sanada mizuki sanada aya mamiya censoredcreampiebig titsMADVcrystal eizoumaniac crystalMADV-511MADV511madv00511
    • 2021-08-25
    35 min

    FC2PPV 2071025 Limited Number! !! [Uncensored] "Why Don’t You Do It With Me？" A Student With Tall Legs Approaching A Lecturer Who Has A Relationship With Her Friend (Part 2) This Is Her Last Work …

  • amateur uncensoredfc2
    • 2021-09-12
    66 min

    200GANA-2556 Seriously Nampa, First Shot. 1688 Picking Up Girls In An Interview With A Cheating Survey! I Found A Very Cute Girl With Outstanding Style! When I Snuggled Up To Her That She Had Been Cheating, She Accepted The Kiss Herself …

  • amateur censoredbig titsamateurganagana-2556gana2556200gana-2556
    • 2021-09-17
    115 min

    FC2PPV 2077268 [Personal Shooting] Slender Beautiful Wife With Outstanding Style Hatsune-San Subjective / Objective Set

  • amateur uncensoredfc2
    • 2021-10-09
    242 min

    [UMSO-419]The Feeling Of Being Enveloped In Her Titties And Her Nipple Feels Simply Too Good!! 27 Of The Ultimate Titty Fuck Masters vol. 02

  • narumiya harua kaho shibuya censoredbig titsUMSOk m produceumanamiUMSO-419UMSO419umso00419



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download