high vision creampie jav mini system shaved




FC2SHKDADNDTTAUKGCAWDPPPDCESDMILKSQTEMARACHRVEBODJULRBDATIDGVHMEYDAUKGBBANBLK

2020-09-10
113 min

[XMOM-023]An Alluring, Lusty Mouth A Blowjob And Sex From A Beautiful Housewife Reiko Sawamura

  • reiko sawamura honami takasaka masumi takasaka censoredcreampieblowjobXMOMcenter villagetenunsighing at sexXMOM-023XMOM023h-086xmom00023
    • 2020-09-13
    126 min

    [USAG-020]Creampie Fucking A Naive College Girl Who Turned Out To Be A Hidden Masochist Pervert - Haruka (22)

  • censoredcreampiebeautiful girlUSAGrabbit daydreamersUSAG-020USAG020usag00020
    • 2020-09-26
    49 min

    10musume 092620_01 POV with a Beautiful Breast Girl Who Loves SEX Yuuka Yamaue

  • amateur uncensored10musume
    • 2020-10-03
    213 min

    [HUNTA-861]"My C***dhood Friend Was Caught In A Sudden Rainstorm, And Now She's Dripping Wet, And I Can See Her Underwear Clear Through Her Clothes, And My Heart Is Pumping Like Crazy!" And Now That Her Body Was Chilled From The Rain, She

  • censoredcreampieblowjobHUNTAhuntermorikihhh groupHUNTA-861HUNTA861hunta00861
    • 2020-10-03
    62 min

    H4610 ki201004 Nami Fujioka 27years old

  • amateur uncensoredh4610
    • 2020-10-18
    115 min

    [DDOB-082]Bukkake: Bossy Career Girl Gets Drenched In Cum Ryo Hitomi

  • ryo hitomi censoredcreampiemature womanDDOBdogmatenunmy auntDDOB-082DDOB082ddob00082
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-11-01
    300 min

    [DKSB-088]Amateur Girls With Excessively Erotic Beautiful Asses Get Piston-Pounded With Dildo Masturbation Pleasure!! 15 Girls 5-Hour Collection 2

  • censoredamateurDKSBoffice k sk s bestDKSB-088DKSB08836dksb00088
    • 2020-11-13
    78 min

    483SGK-003 [I’m doing saffle] [Super sensitive sexual desire] [Beautiful girl camera assistant I love strangling] [Haunted cum convulsions Iki] [Dependence on throat demon Imara] I want to meet you, I like you. Shy Saffle’s Mouth And Oma Co

  • amateur censoredamateursgksgk-003sgk003483sgk-003
    • 2020-11-22
    52 min

    407KAG-109 Inevitable for a naive reaction! !! Full erection for dedication service by S-class beautiful girl of shortcut ww

  • amateur censoredamateurkagkag-109kag109407kag-109
    • 2020-12-18
    63 min

    FC2PPV 1611775 [First time limited 1980] Miraculous beauty busty young wife ❤️ Nagoya super luxury hotel receptionist ❤️ GoTo Travel Stop work due to emergency exclusion ❤️ Help Gonzo raw vaginal cum shot ❤️ Release possibility ant!

  • amateur uncensoredfc2
    • 2020-12-24
    121 min

    [GS-369]This Alluring Lady Came At You With A Reverse Night Visit Because She Was Hungry For Cock I Went On A Business Trip Out Into The Country Where There Was Absolutely Nothing To Do, So I Stayed The Night At A Hot Spring Resort Inn, Dejected And

  • censoredGSsosoru x garconspada ikebukuroGS-369GS3691gs00369
    • 2020-12-31
    63 min

    345SIMM-586 Beautiful Breasts Young Wife Enjoys Creampie 3 Times According To Home Cheating Video

  • amateur censoredcreampiemarried womansimmsimm-586simm586345simm-586
    • 2021-01-07
    127 min

    [JRZE-020]She's Entering The Biz At 50! Kiyo Morino

  • takayo morino censoredcreampiemature womanJRZEcenter villagedaichi minamijurakuJRZE-020JRZE020h-086jrze00020
    • 2021-01-08
    130 min

    [HODV-21541]Pleasure Syndrome Case 5 "Abnormal Lust! Breaking In An Absolute Masochist - Smoking Hot Model Babe Wants To Sub." Aya Shiomi

  • aya shiomi censoreddeepthroatsingle workHODVh m pHODV-21541HODV215415642hodv21541
    • 2021-01-18
    51 min

    IDJS-033 Reiko

  • amateur censoredamateurblowjobidjsidjs-033idjs033idjs-033
    • 2021-01-21
    239 min

    [MADM-137]Forty-something Madam, Follow-up Filming SEX 2

  • kana toyama yuka hirose censoredcreampiebig titsMADMcrystal eizokumataro morinomadam maniacMADM-137MADM13749madm00137
    • 2021-02-06
    102 min

    FC2PPV 1673452 [Black 3P x NTR x personal shooting] Deviation value 70! Black Mara Completely Fallen Kei ○ Girls! The strongest black tag in front of her boyfriend is a 21-year-old talented JD with a black thick 3P decamara rarely inserted and vagina

  • amateur uncensoredfc2
    • 2021-02-14
    125 min

    [ARM-951]Wet Stained Panty Shot And Pussy Juice Dripping Masturbation

  • kozomi hoshinaka rion izumi censoredanalARMaroma planningmania satoshiaromaARM-951ARM951arm00951
    • 2021-02-16
    44 min

    S-Cute tat_072 Gonzo out of a naive girl with an innocent face / Aoi

  • amateur censoredcreampieamateurtattat-072tat072tat-072
    • 2021-03-02
    70 min

    FC2PPV 1708760 [Complete amateur 102] JD Elina 19 years old, everyone loves idol class beautiful girl, vaginal cum shot from the beginning!

  • amateur uncensoredfc2
    • 2021-03-06
    135 min

    [JUL-488]This Legendary Actress Is Starring In A Serious Drama, No.1 In An Exclusive Series!! When We Were Young, I Used To Play With Her, But Now That She's All Grown Up, I Realized, For The First Time, That She Was My Favorite "Madonna,&quo

  • kazama yumi censoredbig titsmature womanJULmadonnahiroyuki kimuraJUL-488JUL488jul00488
    • 2021-03-12
    65 min

    [orec-718]れいちゃん

  • amateur censoredcreampieamateurorecorec-718orec718orec-718
    • 2021-03-12
    138 min

    [SUPA-574]Becoming My Sex Friend - Kanon

  • censoredcreampieamateurSUPAskyu shirotogenius hizaSUPA-574SUPA574h-244supa00574
    • 2021-03-27
    135 min

    [KNAM-036]Completely Raw Styles @ Remon Half Black S********l Who Goes To International School Remon Sawa

  • sawa lemon censoredcreampieuniformKNAMfirst star100 raw styleKNAM-036KNAM036h-491knam00036
    • 2021-04-08
    210 min

    [ABW-078]【MGSだけのおまけ映像付き 20分】顔射の美学 14 美女の顔面に溜まりに溜まった白濁男汁をぶちまけろ！！ 蜜美杏

  • amateur censoredbig titsamateurabwabw-078abw078abw-078
    • 2021-04-16
    115 min

    [PARATHD-3157]- Dedicated To All The People Who Couldn't Visit Their Families During The Lockdown - A Live Broadcast Of Virtual Sex With A Stepmom And Little Stepsister Who Live Back Home Complete Edition

  • yuka hirose momojiri kano censoredstepmomsisterPARATHDparadise tvPARATHD-3157PARATHD3157parathd03157
    • 2021-04-29
    52 min

    H4610 ki210429 Mikako Sagawa 22years old

  • amateur uncensoredh4610
    • 2021-05-01
    63 min

    SIRO-4505 [First shot] [Innocent girl] [Natural H cup daughter] A shy and pure active college student participates in the war. While she was listening to the story, she was attracted to her charm and took off her cute clothes .. AV application on the

  • amateur censoredbig titsamateursirosiro-4505siro4505siro-4505
    • 2021-05-21
    144 min

    [JUL-586]I Heard My Adorable Younger Step Sister Who I Took Care Of For 12 Years Was Getting Married And Fucked Her Raw Out Of Jealousy Hana Shirato

  • white peach censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-586JUL586jul00586
    • 2021-06-25
    129 min

    [ECB-146]Man, Stop Being A Cherry Boy. Miho Tono

  • miho tsuno censoredblowjobsingle workECBwaap entertainmentkurumi ichinosecobra warpECB-146ECB1462ecb00146
    • 2021-06-26
    67 min

    [DANDAN-003]She Can Never Say No! Nurse With H-Cup Tits Devotedly Services Her Patients With Titty Fucking Miss Arioka

  • censoredbig titsblowjobDANDANdandytanaka baconDANDAN-003DANDAN0031dandan00003
    • 2021-07-02
    148 min

    [BBAN-334]The Winner Is The Queen, And The Loser Is Her Servant Hostess Lesbians Himari Kinoshita Rika Aimi

  • himari kinoshita himari hanazawa rumi tadami censoredlesbianBBANbibianBBAN-334BBAN334bban00334
    • 2021-07-09
    34 min

    FC2PPV 1892532 [Mitsuha] Blame the glans until the tide blows with a big smile! A man’s squirting with a pursuit handjob that does not stop even if it gets caught! part49 [Small Devil OL]

  • amateur uncensoredfc2
    • 2021-07-19
    65 min

    HHSI-005 Karen

  • amateur censoredamateurhhsihhsi-005hhsi005hhsi-005
    • 2021-08-06
    68 min

    H0930 ki210808 Chiharu Kawamura 31years Old

  • amateur uncensoredh0930
    • 2021-08-06
    203 min

    [IPX-708]The National Idol Is The Powerful Man"s Sex Toy. Secretly Meeting In A Love Hotel Sex Video Kana Momonogi

  • kana momonogi censoredbig titssingle workIPXidea pockettissueIPX-708IPX708ipx00708
    • 2021-08-13
    47 min

    FC2PPV 2019587 [God Work] The Result Of Renting The No. 1 Active Lady ◯ For One Day … [Part 1]

  • amateur uncensoredfc2
    • 2021-08-20
    118 min

    [NNPJ-463]Nympho Gal Bitch: She"s Happily Go Home With You And Let You Do Whatever You Want To Her Pussy - Ema-chan

  • censoredcreampieamateurNNPJnampa japanNNPJ-463NNPJ463nnpj00463
    • 2021-08-20
    178 min

    [URE-070]Naruto Chuka Original: Female Teacher Kyoko - Pleasure Breaking In Room - The Legendary Female Teacher Training Comic Is Getting A Live Action REmake Once More!! Minami Hatsukawa

  • hatsukawa minami censoredmature womansingle workUREmadonnakitorune kawaguchiure komiURE-070URE070ure00070
    • 2021-09-03
    122 min

    [ADN-344]The Story Of How The Woman I Hired Gave Me A Super Erotic Blowjob Iroha Natsume

  • natsume saiharu censoredblowjobsingle workADNattackersdoragon nishikawaotona no dramaADN-344ADN344adn00344
    • 2021-09-09
    116 min

    [DLDSS-029]Amazing Blowjobs From A Teacher With A Snake Tongue Who Teases And Sucks My Rod Until I Go Crazy During Our Sloppy Cum Filled Date Tina Nanami

  • nanami tina censoredblowjobsingle workDLDSSdahliatake dDLDSS-029DLDSS0291dldss00029
    • 2021-09-11
    155 min

    [MDBK-197]Big Tits Hotel Guest Room: Closed Room Raw Intercourse - Go To Sex Accomodation Plan

  • hamazaki mao arioka miu censoredcreampiebig titsMDBKk m producemaruto takashibazookaMDBK-197MDBK197mdbk00197
    • 2021-09-18
    125 min

    [MRSS-121]Younger Playboy Keeps Tons Of Videos On His Phone Of My Dear Wife Enjoying Cheating Creampie Sex. Yuna Kitano

  • yuna kitano censoredcreampiebig titsMRSSmisesu no sugao emanuelyumesaki ichiroumisesu no sugaoMRSS-121MRSS121mrss00121
    • 2021-09-27
    129 min

    FC2PPV 2255291 [Tif2019 Appearance A ○ Dollar] ~ Limited Quantity ~

  • amateur uncensoredfc2
    • 2021-10-01
    34 min

    FC2PPV 2281430 [No] [Limited To 100 Pieces 2980 → Off To 1480pt!] Excited To Be Seen By People! Metamorphosis Beauty ♥ ️ Even Though I Have A First-Class Secretary Test … Lol, ♥ ️ Massive Vaginal Cum Shot! !! ♥ ️ * Review Benefits / High Image Q

  • amateur uncensoredfc2
    • 2021-10-21
    33 min

    FC2PPV 2363197 Until Today! Appearance! "# 6-2" Company Clerk. Creampie While Letting Her Loved Woman Say "I Like It. I Love It". ♡ Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-10-21
    50 min

    413INST-176 [Married Woman / Orgy Individual Shooting] Big Breasts I Cup ★ Spodim Married Woman Who Trains To A Super Body Like A Model. It Falls Alive By Being Stabbed By A Big Cock Near A Mama Friend. Of Course, Plenty Of Seeding! (Rinne)

  • amateur censoredcreampiebig titsinstinst-176inst176413inst-176



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download