high vision creampie censored masturbation javcensored




FC2SDABNNPJSANHZGDAVSAADNABWNACRMIDEMILKMIDVFSDSSPPPDCHRVBLKSTARSNGODCJODONEZNACX

2020-12-16
46 min

[opcyn-133]さとみ(22)

  • amateur censoredamateuropcynopcyn-133opcyn133opcyn-133
    • 2020-12-18
    179 min

    [GZAP-036]A Sugar Daddy-Hunting J* Is Taking A Bath With A Creepy Lolicon Customer And Subjected To His Filthy Acts

  • censoredcreampieGZAPprestigeelectric trainzapGZAP-036GZAP036118gzap00036
    • 2020-12-26
    73 min

    H4610 ki201226 Rrquest

  • amateur uncensoredh4610
    • 2020-12-27
    48 min

    H4610 ori1744 Sayaka Arahashi 20years old

  • amateur uncensoredh4610
    • 2021-01-10
    153 min

    [APOD-041]Clothing Store Clerk Miku (20) Has Her Face Coated In Gallons Of Cum Bukkake! Made To Walk Around Town After A Facial! Miku

  • censoredamateurbukkakeAPODapollo daydreamersapollo apollo daydreamersAPOD-041APOD041apod00041
    • 2021-01-15
    66 min

    [YMDS-015]A Delivery Gal! It's A SK**ls Challenge To See How Many Cum Shots She Can Fire Off! A Death Match To See How Many Cum Shots Ayuka Kuroda Can Ejaculate!

  • ayuka kuroda censoredcreampiehandjobYMDSmomotaro video publishinghimrockyoung peachYMDS-015YMDS015ymds00015
    • 2021-01-20
    116 min

    [ARM-945]Nagara Succubus - The Pleasure Of Busting Nuts In Your Spare Time

  • rion izumi star ameri censoredblowjobhandjobARMaroma planningkijin kasaiaromaARM-945ARM945arm00945
    • 2021-02-12
    244 min

    [UMSO-374]"This Is Your First Time？! Well Then, I'll Teach You How To Feel Good!" Pretty Babe Shows Off Her Polished Sex SK**ls To A Male Virgin!

  • censoredUMSOk m producejun nagasawaumanamiUMSO-374UMSO37484umso00374
    • 2021-02-19
    90 min

    483SGK-014 [Satomi Ishihara] [Cute and erotic super S class] [Wet and wet flood constitution] [Natural bristles] [Immediately climax constitution] Satomi Ishihara ● Similar beautiful girl! Super S-class entertainer-class Kawaiko-chan! A bristle jungl

  • amateur censoredamateursgksgk-014sgk014483sgk-014
    • 2021-02-22
    61 min

    Caribbeancom 022221-001 Seductive Big Tits School Teacher Yukie Natsuki

  • yukie natsuki uncensoredcreampiehandjobcaribbeancom
    • 2021-03-05
    96 min

    FC2PPV 1712427 [No vaginal cum shot] Tied up with Rorikko Miu-chan ♡ Gorigori toys blamed for vaginal cum shot! 【selfie】

  • amateur uncensoredfc2
    • 2021-03-06
    120 min

    [PRED-293]When We Missed Our Last Train Home, I Ended Spending The Night At A Love Hotel With My Colossal Tits Colleague. Our Bodies Fit Together Excessively Well, So We Kept On Creampie Fucking Until The Break Of Dawn ... JULIA

  • julia censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-293PRED293pred00293
    • 2021-03-06
    47 min

    FC2PPV 1714707 [1000 until 3/20] 150cm OL Umi-chan, 22 years old Saffle is 1H a month, so I’m frustrated and apply for Gonzo

  • amateur uncensoredfc2
    • 2021-03-06
    132 min

    [BBAN-314]Lesbian Gray: What Earns More？ Cash Or A Woman's Body...

  • satoshi kuruki misono waka censoredlesbianbeautiful girlBBANbibianBBAN-314BBAN314bban00314
    • 2021-03-12
    39 min

    [tyvm-140]ひなみ(36)

  • amateur censoredcreampiebig titstyvmtyvm-140tyvm140tyvm-140
    • 2021-03-12
    59 min

    FC2PPV 1717012 [No x facial] A large amount of sperm is shot on a beautiful face … (NO.006 Naughty-chan / Second half) "Personal shooting / Gonzo"

  • amateur uncensoredfc2
    • 2021-03-19
    120 min

    [KSBJ-126]A Smart Mom's Spartan Sex Training Yu Kawakami

  • yu kawakami morino morino censoredblowjobmature womanKSBJksb kikaku emmanuellebito sakuraKSBJ-126KSBJ126ksbj00126
    • 2021-03-21
    159 min

    [JUL-510]20 Years Old, G-Cup Titties, A Mother Of Two C***dren. Aika-san Her Adult Video Debut!!

  • censoredbig titsmomJULmadonnamametaro mamezawaJUL-510JUL510jul00510
    • 2021-03-31
    65 min

    SIRO-4448 [First shot] [Licking beautiful breasts] [S-class looks x beautiful body] A small-faced receptionist with a high sense of beauty appears. A beautiful body that reacts sensitively while being embarrassed .. AV application on the net → AV exp

  • amateur censoredamateursirosiro-4448siro4448siro-4448
    • 2021-04-02
    98 min

    [SHKD-940]Don't Touch My Step Sister, She's Mine! Rin Kira Aoi Kururugi

  • kira rin aoi kururugi censoreduniformsisterSHKDattackerskazuki kuryusharkSHKD-940SHKD940shkd00940
    • 2021-04-02
    243 min

    [HODV-21568]Mitsuki Nagisa Best

  • scooping censoredcreampiecosplayHODVh m pHODV-21568HODV215685642hodv21568
    • 2021-04-03
    98 min

    300NTK-546 Matches Beautiful Big Tits Beauty With A Growing J Cup! !! Libido is also growing acclaimed and high premature ejaculation boyne like a boy’s junior high school student! !! With a treasure body that blows away your consciousness and a

  • amateur censoredcreampiebig titsntkntk-546ntk546300ntk-546
    • 2021-04-09
    121 min

    [MDTM-718]Full POV Quickie Impregnation Sex Submissive Maid Aoi Nakajo

  • nakagusuku censoredcreampiebeautiful girlMDTMuchu kikakutodoMDTM-718MDTM718mdtm00718
    • 2021-04-17
    61 min

    HEYZO 2500 Hot Slut Babe Really Loves Anal Drilling – Momoka Ogawa

  • momoka ogawa uncensoredcreampieheyzo
    • 2021-04-17
    164 min

    [HND-971]This Girl (With A Hot Pussy) Loves Boys (And Their Cocks) Too A Fresh Face And Intellectual Bisexual Beautiful Girl With A Nice Personality Makes Her Creampie Adult Video Debut Izumi Hori

  • izumi hori yui hatano censoredcreampiebeautiful girlHNDhon nakayurukoHND-971HND971hnd00971
    • 2021-04-24
    46 min

    492JCHA-019 I want a woman to talk to me 1

  • amateur censoredbig titsschoolgirljchajcha-019jcha019492jcha-019
    • 2021-05-22
    125 min

    [XTRM-004]Intense Throw Up Discipline Masochistic Girl Has The Back Of Her Throat Used As A Toilet Kaori Shimozono

  • shiorizono kaori censoredcreampiedeepthroatXTRMtoyohikozarakiseiunkai ekusutorimuXTRM-004XTRM004xtrm00004
    • 2021-05-25
    70 min

    Caribbeancom 052521-001 Sex Orgy : 2 Horny Girls Compete Against Each Other For Hard and Big Dick! Eri Hoshikawa, Maki Kawano

  • eri hoshikawa uncensoredcreampielesbiancaribbeancom
    • 2021-06-05
    62 min

    519MAZOF-001 [Yabaizo 29 years old H cup OL] Abnormal situation Luxury foreign car dealer reception ♀ After work, just pull the nipple with the highest sensitivity and faint in agony. Skewered with a vibs toy reason collapse acme. Creampie [meat urin

  • amateur censoredcreampiebig titsmazofmazof-001mazof001519mazof-001
    • 2021-06-10
    59 min

    200GANA-2503 Seriously Nampa, first shot. 1646 Shibuya Nampa at Tay of Awareness Survey on Flirtation! Experienced but shy! Slender, beautiful breasts, nice ass are cute gals who react in both talk and H! He was the owner of the finest body with all

  • amateur censoredamateurganagana-2503gana2503200gana-2503
    • 2021-06-15
    70 min

    FC2PPV 1870097 [Healthy beauty] Futsal circle female college student 19 super-fine body trembling and begging for vaginal cum shot many times! Gorigori SEX without sexual desire of sports girls leaked from saffle personal shooting [Gachi]

  • amateur uncensoredfc2
    • 2021-06-19
    120 min

    [CAWD-239]This Endlessly Rebellious Girl Is Getting Her Tongue Pierced! She Always Dreamed Of Living A Rock N' Roll Life And Wanted To Bare Her Maso Soul So That's Why She's Becoming An Adult Video Actress! Emika Asagiri

  • emika asagiri censoredsquirtingsingle workCAWDkawaiiinaballCAWD-239CAWD239cawd00239
    • 2021-06-25
    152 min

    [MIDE-947]Blowjob-Loving Girl Deep Throating + Heavy Ejaculations + Repeated Sucking Nao Shinguji

  • jinguji temple nao censoredbig titsblowjobMIDEmoodyzmoodyz divaMIDE-947MIDE947mide00947
    • 2021-06-26
    67 min

    [DANDAN-003]She Can Never Say No! Nurse With H-Cup Tits Devotedly Services Her Patients With Titty Fucking Miss Arioka

  • censoredbig titsblowjobDANDANdandytanaka baconDANDAN-003DANDAN0031dandan00003
    • 2021-06-29
    53 min

    C0930 ki210629 Sachie Hasegawa 47years old

  • amateur uncensoredc0930
    • 2021-07-02
    120 min

    [ATID-469]Enema Demon: Anal Ecstasy And Breaking In Just Before Marriage - Elena Takeda

  • elena takeda censoredanalsingle workATIDattackerseitaro hagaein madATID-469ATID469atid00469
    • 2021-07-06
    62 min

    HEYZO 2557 Orgasms With A Horny Pussy Girl Vol.18 – Asuka Motomiya

  • asuka motomiya uncensoredcreampieheyzo
    • 2021-08-17
    54 min

    230OREC-860 Shiro usa-Chan

  • amateur censoredcreampieamateurorecorec-860orec860230orec-860
    • 2021-09-10
    158 min

    [HUNBL-059]When She Feels True Pleasure For The First Time

  • censoredsquirtingdeepthroatHUNBLhuntergeminihhh groupHUNBL-059HUNBL059hunbl00059
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-11
    241 min

    [UMSO-414]The Y Balance Sex Of A Soft-bodied Beauty!

  • riko kitagawa ririka censoredcreampiebig titsUMSOk m produceumanamiUMSO-414UMSO414umso00414
    • 2021-09-24
    137 min

    [JUL-718]This Married Woman Was Unleashing A Furious Windstorm Of Ass-Shaking Sex, Dripping With Sweat, And I Ended Up Creampie Injecting Her Without Ever Moving A Muscle. Maiko Ayase

  • maiko ayase maria sawaguchi censoredcreampiemature womanJULmadonnakoyama masatsuguJUL-718JUL718jul00718
    • 2021-10-14
    57 min

    299EWDX-385 Nipples Stand Up Too Much! A Delicate Body That Seems To Break! A Famous Instrument! Creampie!

  • amateur censoredcreampiemarried womanewdxewdx-385ewdx385299ewdx-385
    • 2021-10-22
    240 min

    [HNDB-202]Quickies Right After Meeting! Instant Orgasms! Fucking Resumes While Her Pussy"s Still Spasming After A Creampie! "I"m Already Coming!" Ignoring Her Resistance, We Keep Fucking And Creampie-ing Her!! 4 Hours Of Continuous Or

  • mitsuki kamiya hill erina censoredcreampiebeautiful girlHNDBbookHNDB-202HNDB202hndb00202
    • 2021-10-24
    54 min

    FC2PPV 2369213 [Fc2 Shot] Appearance! Amateur Female College Student [Limited] Aspiring Female Announcer ☆ Beautiful 21-Year-Old Miku Neat Sister! Enjoy Train Lovers, Smart Women, And Purely Intelligent Women! !! I Still Dig Up The Shame Of The Beaut

  • amateur uncensoredfc2
    • 2021-10-27
    38 min

    FC2PPV 2377322 [38 Minutes 3 Shots] A Younger Sister Who Is Very Similar To The Actress Passed The Interview. Uncut 3 Shots Cum Swallowing. Cum Circle ＃ 17

  • amateur uncensoredfc2
    • 2021-11-01
    123 min

    [NACR-479]Rumor That Moving Company Lady Is A Tight Lady With Big Ass Hana Himesaki

  • himesaki hana censoredcreampiebig titsNACRplanet plushimurokkushichi ku ryuuNACR-479NACR479h-237nacr00479
    • 2021-11-03
    94 min

    300MAAN-715 [Erotic M Do Metamorphosis Nursery Teacher] A Super Strong Man With An Anecdote That The Nursery School Was Dismissed By Forbidden Erotic Acts Appeared! !! While Shaking The Huge Breasts Of The H Cup, Devouring Sexual Desire, Ascending Ma

  • amateur censoredcreampiebig titsmaanmaan-715maan715300maan-715



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download