high vision censored javcensored jav restraint




FC2NGODCHRVDASDSDABJUFENATRMIDVPPPDDTTGVHAWDSANSSISMILKJULVENUONEZSSNIWAAAMARA

2020-12-27
120 min

[BIJN-191]The Documentary She's Baring Her Instinct To Fuck And Enjoy Orgasmic Sex A Tall And Beautiful Married Woman Moans And Groans In Mind-Blowing Orgasmic Pleasure Kotono Nanasaki

  • kotono nanasaki censoredcreampiesingle workBIJNbijin majo emmanuelleBIJN-191BIJN191bijn00191
    • 2020-12-31
    120 min

    [SSNI-952]The Wife Of My Part-Time Job's Boss Is Too Much Of A Pervert For My Body To Handle... Saki Okuda

  • saki okuda censoredsluthandjobSSNIs1 no 1 stylekitorune kawaguchiSSNI-952SSNI952ssni00952
    • 2021-01-09
    60 min

    FC2PPV 1631513 Episode 131 [Amateur Gonzo] 18-year-old Mashiro Ishihara Gonzo in uniform Pile driving cowgirl (Daddy activity, back dirt girls) [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-14
    16 min

    HEYZO 2435 Sena’s Amazing Hand Job – Sena Sakura

  • sena sakura uncensoredhandjobheyzo
    • 2021-01-21
    81 min

    FC2PPV 1653421 [Active CA, 6th] Ayumi-san ♡ 24 years old ♡ I will do my best for money! ♡ Series first mask shooting ♡ With benefits [Appearance NG]

  • amateur uncensoredfc2
    • 2021-01-22
    60 min

    SIRO-4400 [First shot] [During engagement ..] [Osaka beauty shaking G milk] Immoral sex attracted by G milk OL during engagement. She desperately holds another stick and tastes the cum many times .. She applies for AV on the net → AV experience shoot

  • amateur censoredbig titsmarried womansirosiro-4400siro4400siro-4400
    • 2021-01-24
    54 min

    FC2PPV 1658307 [Personal shooting] Sex with a perverted fifty aunt who can’t control her lust!

  • amateur uncensoredfc2
    • 2021-02-12
    76 min

    FC2PPV 1678932 [No x Semi-outside Creampie] ★ Naughty ★ After having fun at the amusement park, have sex at the inn …!？ “Personal shooting”

  • amateur uncensoredfc2
    • 2021-02-17
    72 min

    [opcyn-151]あやせ(20)

  • amateur censoredbig titsamateuropcynopcyn-151opcyn151opcyn-151
    • 2021-02-20
    57 min

    10musume 022021_01 Not Wearing Make up Amateur : I put makeup on even I go out for a small errand Sanae Kiuchi

  • amateur uncensored10musume
    • 2021-03-03
    120 min

    [PFES-009]My Very Own Lingerie Model Starting One Night The Hottest Girl In My Company Couldn't Result My Seduction And I've Been Fucking Her Raw Since Yu Shinoda

  • shinoda yu censoredcreampiebig titsPFESpremiumtrendy yamaguchisummer panties festivalPFES-009PFES009pfes00009
    • 2021-03-05
    29 min

    FC2PPV 1658698 [First time limited 1980pt → 1200] GoPro video full of immersive feeling ❤️ Trajectory to M woman ❤️ Fainting convulsions with a thick vibe after insulting an active beautiful girl JD who is too beautiful with a ball gag ❤️ Superb blow

  • amateur uncensoredfc2
    • 2021-03-06
    116 min

    [SSIS-007]When My Husband Was Away For 3 Days, I Kept Getting Roughly Fucked By His Boss. Marin Hinata

  • marin hinata censoredsingle workSSISs1 no 1 styleamazing meatSSIS-007SSIS007ssis00007
    • 2021-03-12
    74 min

    374SHOW-049 Kaede

  • amateur censoredamateurshowshow-049show049374show-049
    • 2021-04-01
    55 min

    C0930 ki210401 Yuriko Takasugi 31years old

  • amateur uncensoredc0930
    • 2021-04-01
    119 min

    [278GNAB-052]ロリ催淫 母性を無限増殖できる催淫ガラガラを人畜無害のロリっこに使ってオギャってマンマンパ！！！

  • amateur censoredamateurgnabgnab-052gnab052278gnab-052
    • 2021-04-05
    44 min

    498DDH-005 [Shared Room NTR] Cheeky Black Gal At a hotel on a business trip with a boss who hates new employees … [Seeding press]

  • amateur censoredcreampiebig titsddhddh-005ddh005498ddh-005
    • 2021-04-11
    47 min

    HEYZO 2497 I Love Sex! PTM Fuck With A Fuckster! – Yu Nagata

  • yu nagata uncensoredcreampieheyzo
    • 2021-04-16
    54 min

    FC2PPV 1773301 [Uncensored] When I met him for the first time in a long time, he turned into a super popular hostess, but Ji ● Po addiction does not heal Former J ● Refre Miss hostess: Mai (19 years old)

  • amateur uncensoredfc2
    • 2021-04-24
    158 min

    [LULU-067]My Adorable Girlfriend's Terrifying Stepdad Was Out For The Day, I Spent The Whole Time Nailing Her From Dawn To Dusk - French Kisses And Creampies Wan Horikita

  • horikita wan censoredcreampieschoolgirlLULUlunaticsluminaxLULU-067LULU067lulu00067
    • 2021-04-29
    120 min

    [GS-2014]True Stories: Family Fun Special Extra Edition [29] Afterwards -

  • censoredGSgosGS-2014GS2014
    • 2021-05-04
    63 min

    300NTK-564 [Tsunts Upward Big Breasts Layer Docha Wet Infinite Infinity Climax Edition] If you mix an aphrodisiac with a popular layer, it will get wet on the floor Warning! !! Tide & tide overflowing from the bed! !! Where is the water vein in su

  • amateur censoredcreampiebig titsntkntk-564ntk564300ntk-564
    • 2021-05-07
    175 min

    [NHDTB-525]Faithless Wife In Sexy Lingerie Seduced The Hung Neighbor Next Door And Now He Won't Stop Drilling Her No Matter How Many Times She Cums

  • censoredsquirtingslutNHDTBnatural highremonha to nakashimaNHDTB-525NHDTB5251nhdtb00525
    • 2021-05-21
    52 min

    509JPAK-012 Yuzu

  • amateur censoreduniformschoolgirljpakjpak-012jpak012509jpak-012
    • 2021-05-22
    167 min

    [DGCEMD-011]*Delivery Only! Bonus Video Included* 5 Seconds Before The Cock Breaks! A Full-course Slut Who Doesn't Hold Her SEX Back - Honoka Tsujii

  • tsujii honoka censoredbig titsblowjobDGCEMDcelebrity friendsDGCEMD-011DGCEMD011dgcemd00011
    • 2021-06-10
    115 min

    [NHDTB-539]Searching For Creampie Sluts - Going With A Group Of Gals For A Day And Fucking All Of Them -

  • censoredcreampiesquirtingNHDTBnatural highjanken kotamaNHDTB-539NHDTB5391nhdtb00539
    • 2021-06-11
    240 min

    [MIZD-237]Barely Legal Pussy Fucked! Uniformed Girl Fucked By A Dick - Perfect Climax Complete BEST

  • blue abe mikako censoredcreampieMIZDmoody smoodyz bestMIZD-237MIZD237mizd00237
    • 2021-06-13
    102 min

    390JNT-022 [G Breast Whip Whip Married Woman] I ● Put an erotic selfie on the star, pick up a G cup married woman on SNS! !! The real married woman of transcendental Eros that overwhelms the actor is too fierce! !! Squeeze sperm while cramping BODY a

  • amateur censoredcreampiebig titsjntjnt-022jnt022390jnt-022
    • 2021-06-15
    50 min

    HEYZO 2548 That Beautiful MILF Is My Mother’s Friend – Sakura Kazuki

  • sakura kazuki uncensoredcreampieheyzo
    • 2021-06-22
    61 min

    1Pondo 062221_001 M Slut: Mari Onodera

  • amateur uncensored1pondo
    • 2021-07-09
    177 min

    [IPX-682]Hot Kisses and Sweaty Sex with a Pure Beatiful Girl. Kotoyumi Ono.

  • kotoyumi ono censoredblowjobbeautiful girlIPXidea pocketusa pyondishIPX-682IPX682ipx00682
    • 2021-08-13
    54 min

    1Pondo 081321_001 Mature Cosplay Nana Kamiyama

  • amateur uncensored1pondo
    • 2021-08-21
    241 min

    [MDBK-195]"I Really Want Your Rock Hard Cock" This 4 Hour Collection Of Girls Talking Dirty To Seduce You Will Melt Your Brain!

  • kimi and ayumi sarina kurokawa censoredcreampieslutMDBKk m producek taroubazookaMDBK-195MDBK195mdbk00195
    • 2021-08-29
    42 min

    292MY-460 Sho Miyoshi 2

  • amateur censoredcreampiemarried womanmymy-460my460292my-460
    • 2021-09-03
    69 min

    529STCV-011 Kanon-Chan (18)

  • amateur censoredcreampiebig titsstcvstcv-011stcv011529stcv-011
    • 2021-09-13
    58 min

    328HMDN-407 [Individual, 60th Road] Big Breasts Sexual Intercourse With G Cup Mother’s Sister. Gonzo Out Her Aunt Who Had Been Getting Nui From The Dc Era

  • amateur censoredcreampiemarried womanhmdnhmdn-407hmdn407328hmdn-407
    • 2021-09-28
    71 min

    355OPCYN-183 Hana 2

  • amateur censoredmarried womanamateuropcynopcyn-183opcyn183355opcyn-183
    • 2021-10-01
    128 min

    [JUTA-122]The Best!! A 30-something WIfe"s First Undressing AV Document - Yukina Morisawa

  • yukina morisawa censoredcreampiebig titsJUTAjuku onna japan emmanuellekongouriki marujuku onna japanJUTA-122JUTA122juta00122
    • 2021-10-02
    156 min

    [XVSR-617]Masked Couple Complete Edition Final Chapter, Perverted Couple Loves Cheating Play Hibiki Otsuki Yui Hatano

  • otsuki sound yui hatano censoreddramaXVSRmax ak c takedacalenXVSR-617XVSR617xvsr00617
    • 2021-10-07
    56 min

    FC2PPV 2306598 18-Year-Old Ubukawa Student Who Wants To Be A Ba. I’m So Excited To Feel It For The First Time In My Life! I Have Vaginal Cum Shot Without Permission.

  • amateur uncensoredfc2
    • 2021-10-09
    150 min

    [MDBK-202]The Female Doctor Who Has Big Tits: Obscene and Unprotected Sex Counseling

  • arioka miu anri namiki censoredcreampiebig titsMDBKk m producebazookaMDBK-202MDBK202mdbk00202
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-29
    124 min

    [CAWD-311]Light Skin Girl With Black Hair And Hot Nipples Takes A Big Dick For The First Time, Giving Her A Deep Penetrating Orgasm! This Beautiful Girl Comes From Tohuku, Home Of Light Skin Beauties. Mikuru Mashiro Makes Her Debut.

  • pure white mikuru censoredsingle workCAWDkawaiikimura hiroyukiCAWD-311CAWD311cawd00311
    • 2021-11-06
    110 min

    [NSFS-039]House of Cuckoldry 2 - Wife Made Into Dutch Wife Yumi Saeki Kaori

  • yuka saeki censoredmature womansingle workNSFSnagae stylenagaeNSFS-039NSFS039nsfs00039
    • 2021-12-18
    131 min

    [GTJ-099]Anal Open Season Sudden Rosebud Shiomi Aya

  • aya shiomi censoredanalcreampieGTJdogmatohjirogold tohjiro levelGTJ-099GTJ099gtj00099
    • 2021-12-23
    76 min

    200GANA-2638 Seriously Nampa, First Shot. 1732 Santakos’s Gekikawa Girls Bar Clerk And Hotel In! The Finest Slender Body With No Wasted Meat! A Type Of Actor Pierces The Back Of The Vagina And Panting And Cums Continuously! (Hasumi Takashi)

  • amateur censoredamateurcosplayganagana-2638gana2638200gana-2638
    • 2022-01-02
    210 min

    502SEI-003 <If You Imitate It, You Will Definitely Be Squid>! A Complete Lecture With Sex Professionals Practicing Really Pleasant Sex [AV That Can Be Made Into A Textbook] (Sarina Momonaga)

  • amateur censoredbig titsamateurseisei-003sei003502sei-003
    • 2022-01-14
    133 min

    [HODV-21641][Complete POV] Girl With A Dialect. The Okinawan Dialect. Kokono Terada

  • terada here censoredcreampiesingle workHODVh m pHODV-21641HODV216415642hodv21641



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download