high vision censored jav javcensored




FC2NACXNATRGMEMDTTFSDSSSQTEDASDSANWAAAKBIPPPDVENUADNMIDEROYDKSBJNNPJGVHNGODEBOD

2020-05-16
211 min

[HUNTA-772]When I Got Married, My Wife Had 7 Slutty S********l Daughters, And They Were All Horny Bitches! They Were All Lusty Babes Who Were Fully Oozing With Horny Pheromones, And I Could No Longer Resist, So Behind My Wife's Back, While My Ere

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-772HUNTA772hunta00772
    • 2020-05-16
    120 min

    [SSNI-783]I Was Continuously Fucked Underneath The Futon... A 3-Day, 2-Night Graduation Trip During Which Her Big Cock Friend Gave Her A Bucking Bronco Total Coverage Fuck While Her Boyfriend Lay Beside Her, And Although She Felt Guilty, She Enjoyed

  • yura kanno censoredbeautiful girlsingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-783SSNI783ssni00783
    • 2020-05-16
    161 min

    [DVDMS-543]This College Girl Is Living Alone, Prancing Around In Black Pantyhose, And I Couldn't Resist, So I Pumped My Big Cock Into Her From Behind For A Quickie! Then I Grabbed Her Ankles And Thrust Deep Into Her Pussy For Piston-Pounding Sex!

  • censoredcreampieamateurDVDMSdeep sswing nagaseDVDMS-543DVDMS543dvdms00543
    • 2020-05-16
    120 min

    [BLK-457]When This Naughty Gal Gets Busy, She Becomes A Horny Bitch Who Enjoys Cum Swallowing, So She Went Straight Into A Creampie Orgy Fuck Fest. Kaho Imai

  • natsuho imai censoredcreampiebig titsBLKkira kirakira kira black galBLK-457BLK457blk00457
    • 2020-05-16
    182 min

    [SSNI-787]Marin Hinata & Maron Natsuki Double Shaved Pussy Celebrity Sex Massive Squirting Ecstasy A 3-Hour Special

  • marin hinata marin natsuki censoredsquirtingSSNIs1 no 1 stylezaku araiSSNI-787SSNI787ssni00787
    • 2020-05-16
    228 min

    [AP-768]Human Tied Up And Hung Out To Dry

  • censoredcreampieAPapachegeronimohhh groupAP-768AP768ap00768
    • 2020-05-16
    118 min

    [PPPD-841]Cumming All Over Her Tits While Playing With Her Nipples: No Hands O-Cup Titty Fuck Beauty Salon - Hitomi

  • hitomi censoredbig titsblowjobPPPDoppaiPPPD-841PPPD841pppd00841
    • 2020-05-16
    240 min

    [HUNTA-776]Squish! "It... It's So Tight..." My C***dhood Friend's Big Tits Were Squeezing Into My Face, And I Got A Super Hard Erection! I Was Playfully Playing With My Big Tits C***dhood Friend, When Suddenly She Fell On Top Of Me, A

  • censoredcreampiebig titsHUNTAhuntervolvo nakanohhh groupHUNTA-776HUNTA776hunta00776
    • 2020-05-16
    120 min

    [BLK-454]A Convenient Lover Gal This Bitch Loves Dirty Old Men And Wants Relentless And Sticky Sex, So We're Having A Creampie Adultery Fuck Fest Until The Break Of Dawn 04 Ryo Harusaki

  • ryo harusaki censoredcreampiesingle workBLKkira kirakira kira black galBLK-454BLK454blk00454
    • 2020-05-16
    216 min

    [OYC-324]I Learned This Secret That A Beautiful Woman Was Keeping, And I Fitted Her With A Remote-Controlled Vibrator! No Matter Where She Was, No Matter When, I Could Make Her Piss Herself Silly! Once I Learned Her Secret, This Beautiful Woman That

  • censoredcreampieOYCoyashoku.companyhamonhhh groupOYC-324OYC324oyc00324
    • 2020-05-16
    119 min

    [SSNI-790]118 Furious Orgasms! 4,300 Spasms! 1,800cc Of Squirts! A Divine Body With H-Cup Tits An Eros Company Awakening First-Time Massive Spasmic Special Kyoko Shuri

  • tokiko censoredbig titssquirtingSSNIs1 no 1 styledragon nishikawaSSNI-790SSNI790ssni00790
    • 2020-05-16
    177 min

    [PPPD-844]Big Titted Call Girl Makes Her AV Debut: Fuwari (20), G-Cup

  • censoredbig titsblowjobPPPDoppaiPPPD-844PPPD844pppd00844
    • 2020-05-16
    116 min

    [MXGS-1138]This Beautiful Stylist Gal Is Working At A Filthy Beauty Salon Haruka Takami

  • haruka takami censoredbeautiful girlsingle workMXGSmaxingMXGS-1138MXGS1138h-068mxgs01138
    • 2020-05-16
    119 min

    [BLK-458]Nobody Knows What Happens After School This Dirty Old Man Is Having Secret After School Pay-For-Play Sex With A Secretly Bitchy Babe In The Corner Of The Classroom Kanon Kanade

  • kanon kanon censoredcreampieuniformBLKkira kirakira kira black galBLK-458BLK458blk00458
    • 2020-05-16
    123 min

    [MXGS-1137]A G-Cup Big Tits College Girl A Cuckold Oil Massage Hiyori Futaba

  • hiyori futaba censoredbig titsbeautiful girlMXGSmaxingMXGS-1137MXGS1137h-068mxgs01137
    • 2020-05-16
    69 min

    [ETQR-134]My Excessively Emotionally Disturbed Little Stepsister Is Cumming At Me With Sexual Desires! Nozomi Arimura

  • arimura nozomi censoredcreampieuniformETQRerotic timeETQR-134ETQR134h-1186etqr00134
    • 2020-05-16
    115 min

    [ROYD-006]Usually My Little Stepsister Is A Cute Plain Jane With A Big Ass, But Then She Started Showing Off The Total Domain Of Her Pussy, And By The Time I Realized What Was Happening, I Had Creampie Fucked her. Akari Neo

  • akari neo censoredcreampiebeautiful girlROYDroyalcognac kaminohhh groupROYD-006ROYD006royd00006
    • 2020-05-16
    478 min

    [OFJE-246]Shion Yumi In Her First Best Hits Collection Her First S1 Anniversary Her Newest 12 Titles 8-Hour Special

  • evening beauty censoredbig titsschoolgirlOFJEs1 no 1 styleOFJE-246OFJE246ofje00246
    • 2020-05-16
    118 min

    [SSNI-786]For Titty Lovers Only: The Ultimate 104cm Tits - Titty Fuck Maniacs - Mei Washio

  • mei washio censoredbig titssingle workSSNIs1 no 1 styletiger kosakaiSSNI-786SSNI786ssni00786
    • 2020-05-16
    165 min

    [SSNI-780]She's Unwittingly Luring Men To Temptation With Her Clothed Big Tits A Super Lucky Horny Daydream Fantasy Situation Special Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs1 no 1 styletake dSSNI-780SSNI780ssni00780
    • 2020-05-16
    242 min

    [DVDMS-541]A Normal Boys And Girls Focus Group Adult Video When This Office Lady Missed Her Last Train Home, She Ran Into A Business Man For The First Time And They Went Immediately To A Love Hotel For Some Hard And Tight Sex!! The Romantic Mood In T

  • censoredcreampieamateurDVDMSdeep sgreenhouse effectDVDMS-541DVDMS541dvdms00541
    • 2020-05-16
    478 min

    [OFJE-247]21 S1 Ultra Gorgeous Women Vs Me, Just Me I Was Surrounded By Beautiful Women In The Greatest, Most Heavenly Ejaculation Ever In A Luxurious Harlem BEST HITS COLLECTION

  • tsukasa aoi minami kojima censoredsquirtingOFJEs1 no 1 styleOFJE-247OFJE247ofje00247
    • 2020-05-16
    119 min

    [PPPD-842]I Invited A Succubus To My Home And When She Possessed My Big Tits Big Stepsister, Every Day Was Filled With Creampie Semen-Milking Sex JULIA

  • julia censoredcreampiebig titsPPPDoppaiPPPD-842PPPD842pppd00842
    • 2020-05-16
    236 min

    [HUNTA-774]She Was Wearing A Tight One Piece Dress That Totally Showed Off Her Panty Lines, And I Immediately Got Rock Hard!! My Neighbors Are All Wearing Thin And Tight One Piece Dresses That Show Off Their Asses And Curves, So...

  • censoredcreampieblowjobHUNTAhunterkoichi davidsonhhh groupHUNTA-774HUNTA774hunta00774
    • 2020-05-16
    302 min

    [DVDMS-539]Faces Revealed!! The Magic Mirror Number Bus All Ladies, 38 And Over! A Beautiful Married Woman Who Doesn't Look Her Age Her First Public French Kiss Vol.06 A 10-Girl All-Fucking Sex Special!! She's Enjoying Hot Smothering Kisses W

  • censoredamateurDVDMSdeep sswing nagasethe magic mirrorDVDMS-539DVDMS539dvdms00539
    • 2020-05-16
    120 min

    [BLK-455]She Hates Fucking Dirty Old Men, But They Get Her Massively Squirting! She'll Never Acknowledge That She's Cum! A Super Naughty Gal In A School Uniform Is Massively Pissing Herself One Weekend, And This Is The Video Record Of It All

  • suzuka walnut censoredsquirtingblowjobBLKkira kirakira kira black galBLK-455BLK455blk00455
    • 2020-05-16
    191 min

    [HUNTA-773]I Was Peeking Into The Bathroom, When I Witnessed A Mountain Range Of Exquisite Big Tits, And I Got Super Excited!! These Big Tits Young Wife Babes Were Exposing Themselves Freely At The Hot Spring Resort Bath, And Their Huge Titties Were

  • censoredcreampiebig titsHUNTAhuntercognac kaminohhh groupHUNTA-773HUNTA773hunta00773
    • 2020-05-15
    118 min

    [GNAX-029]I Will Make You Cum Over And Over Again Yumi Kazama

  • kazama yumi censoredbig titssingle workGNAXnagiraGNAX-029GNAX029h-1345gnax00029
    • 2020-05-15
    33 min

    [BTH-032]A Bodacious Celebrity With Maso Pride Is Going Cum Crazy At An Aphrodisiac Massage Parlor NAOMI

  • naomi censoredbig titsblowjobBTHchobitchsuper bitchBTH-032BTH032h-1435bth00032
    • 2020-05-15
    163 min

    [HGOT-038]In The Morning, These Mama Friend Secretly Planned An Orgy Party

  • kanna misaki arisa kawasaki censoredcreampieHGOTkuwattiHGOT-038HGOT038h-1414hgot00038
    • 2020-05-15
    120 min

    [REAL-728]I'm About To Fuck Everyone In This Family The Location: Hikari**oka, Neri** Ward

  • scooping toua kotone censoredbeautiful girlREALreal workscomet akaireal real worksREAL-728REAL728172real00728
    • 2020-05-15
    240 min

    [UMSO-316]My Wife Ran Out On Me, And Now I'm A Single Father And Divorcee, But Unbelievably, I'm A Hot Commodity Again!？ These Neighborhood Mamas Took Pity On Me, And Started To Help Me With My Duties, And Now I'm Committing Afternoon Adu

  • censoredcreampiebig titsUMSOk m produceumanamiUMSO-316UMSO31684umso00316
    • 2020-05-15
    64 min

    [ETQR-133]2 Perverts With Complicated Sexual Hangups Go Head To Head Mitsuki Nagisa

  • scooping censoredcreampieuniformETQRerotic timeETQR-133ETQR133h-1186etqr00133
    • 2020-05-15
    168 min

    [NIKM-044]You've Been Waiting For This! A Furiously Fine Woman! A Divine Body! Exquisite Eroticism Lena Kannazuki

  • godless moon censoredbig titssingle workNIKMnikumoripiNIKM-044NIKM044h-1323nikm00044
    • 2020-05-15
    234 min

    [MKMP-336]The Big Tits Female Doctor Counseling Room, Filled With Dirty Bodies That Will Drive Men Wild Waka Misono Mao Kurata Mayu Suzuki

  • misono waka kurata mao censoredbig titsslutMKMPk m produceshizukamanmillionMKMP-336MKMP33684mkmp00336
    • 2020-05-15
    122 min

    [VRTM-500]This Big Tits Big Stepsister Is Worried About Her Cherry Boy Little Stepbrother, So She Decided To Take A Bath With Him! She's Using Her Voluptuous Titties To Hold On Tight To Her Excited Little Stepbrother And Give Him A Hot Body Washi

  • sachiko tsugumi morimoto censoredcreampiebig titsVRTMv r producegoro koenjiVRTM-500VRTM500h-910vrtm00500
    • 2020-05-15
    26 min

    [CLO-040]Coerced Female Teacher. Target: Ema - Ema Kisaki

  • emma kisaki haruki haruki kato censoredbig titsdeepthroatCLOchobitchsuper bitchCLO-040CLO040h-1435clo00040
    • 2020-05-15
    245 min

    [NPS-395]A Real Pickup! Straight Outta Osaka! All It Takes Is A Kiss To Get Her Mouth And Pussy All Moist And Buttery! Juicy And Dripping Pussy Pumping Sex 140 Orgasms 17 Cum Shots!

  • censoredamateurNPSpeterskensuke kikuchinampazuNPS-395NPS395h-021nps00395
    • 2020-05-15
    150 min

    [SUPA-524]Real Amateur - "I Didn't Say You Could Cum Inside Me!" - 4 Modern S********ls Take Surprise Creampies

  • censoredcreampieschoolgirlSUPAskyu shirotok taroSUPA-524SUPA524h-244supa00524
    • 2020-05-15
    176 min

    [DOCP-225]I Went To Welcome The Beautiful Married Woman Who Moved In Next Door, And I Gave Her Some Aphrodisiacs, And Dipped My Cock In Aphrodisiac Lotion, And Had Myself An Insta Fuck! When The Aphrodisiacs Kicked In, This Married Woman Awakened Her

  • himari hanazawa mizuki yayoi censoredcreampieDOCPprestigedoc premiumDOCP-225DOCP225118docp00225
    • 2020-05-15
    121 min

    [BANK-001]My C***dhood Friend Has Super Beautiful Big Tits And A Naughty Body And She'll Fuck Anyone, Anytime, Anywhere, Because She's An Incredibly Horny Bitch! Mayu Suzuki

  • suzuki mayu censoredcreampiebig titsBANKpussy banktake chanBANK-001BANK001h-1495bank00001
    • 2020-05-15
    150 min

    [MDBK-103]She'll Serve Only You A Super Popular Secretary Service That Provides Extra Horny Services

  • shinoda yu hebei haruna censoredcreampiebig titsMDBKbazookak taroMDBK-103MDBK103h-1496mdbk00103
    • 2020-05-15
    68 min

    [STKO-014]An SOD Party Documentary We Took These Ladies Home And Seduced Them The Case Of Mary Tachibana

  • tachibana mary censoredsingle workSTKOsod createmantaro yumetipsy reverse flirtingSTKO-014STKO0141stko00014
    • 2020-05-15
    267 min

    [SKMJ-101]Post-Birth Virgin Babes Only Ultra Exquisite Slobbering And Full-Body Lip Service With Deep And Rich Kisses! She'll Passionately Twist Her Tongue Into Your Mouth And As She Bursts With Overflowing Desire, This Horny Housewife Will Engag

  • censoredcreampiebig titsSKMJred face girlone topSKMJ-101SKMJ101h-1324skmj00101
    • 2020-05-15
    150 min

    [HGOT-036]I Discovered Her Fetish When We Started Living Together

  • blue shiiki walnut censoredcreampiesquirtingHGOTjohnny shibuyaHGOT-036HGOT036h-1414hgot00036
    • 2020-05-15
    300 min

    [WA-428]Picking Up Amateur Housewives All Creampie Raw Footage All The Time 5 Hours Celeb DX Edition 70

  • censoredcreampieamateurWAlotusWA-428WA428h-047wa00428
    • 2020-05-15
    32 min

    [CLO-042]Breast Urinal Sandwich: Office Meeting Aimi Yoshikawa

  • yoshikawa aimi censoredbig titsblowjobCLOchobitchsuper bitchCLO-042CLO042h-1435clo00042
    • 2020-05-15
    271 min

    [SKMJ-102]Nampa Seduction Of Amateur Babes On The Stret Freshly Filmed Creampie Sex "Can I Go To Your House？" In Addition To Checking Out Her Home, This Sex-Filled Special Is Overflowing With Creampie Raw Footage And Cum Face Semen Splatters!

  • censoredcreampieamateurSKMJred face girlxyzSKMJ-102SKMJ102h-1324skmj00102



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download