high visio jav censored voyeur creampie




FC2IPXAUKGKSBJAUKSATIDCHRVVENUAMBINGODMILKROYDDASDVEMAADNAWDMARASSISMIDVSSNIAPOD

2020-11-24
490 min

[SDJS-097]SOD Female Employee The Third Time Blowjob Cinderella Showdown! Bonus Footage - Three Female Employees Throw Down Over Who Has The Most Amazing Dick Sucking SK**ls! Plus 21 Girls Who Didn't Make The Finals! 68 Loads Blown In All! Massiv

  • megumi takagi shingo akahori censoredamateurblowjobSDJSsod createevening publicationsod female employeeSDJS-097SDJS0971sdjs00097
    • 2020-11-26
    120 min

    [ARSO-20140]My Wife -Celeb Club- 140

  • yu matsushima akina inamura censoredblowjobARSOaroundARSO-20140ARSO20140h-1378arso20140
    • 2020-11-27
    239 min

    [YTR-149]Hey, How Many Times Should We Do It Today Before Our Parents Get Home？

  • toua kotone mari kaga censoredcreampieYTRnonYTR-149YTR149h-127ytr00149
    • 2020-12-03
    99 min

    AVKH-187 Ohara Wakana

  • amateur censoredanalamateuravkhavkh-187avkh187avkh-187
    • 2020-12-04
    121 min

    [ONEZ-266]The Story Of How I, A 40-Year-Old Guy With Erectile Dysfunction, Managed To Get A S********l Half My Age To Be My Very Own Cum Dumpster. Chiharu Miyazawa

  • chiharu miyazawa censoredcreampieuniformONEZprestigetodoonezONEZ-266ONEZ266118onez00266
    • 2020-12-04
    115 min

    [PARATHD-3060]A Crowd Of Adorable Girls! French Kisses x Body Fluids Live Broadcast - Complete Edition

  • chiharu miyazawa kiriyama yuu censoredbeautiful girlPARATHDparadise tvPARATHD-3060PARATHD3060parathd03060
    • 2020-12-11
    162 min

    [MDBK-146]Totally Immersive POV Footage! Tied Up Guys x Hard Cowgirl x Continuous Orgasms - Seductive Cowgirl Rodeo Slut

  • shinoda yu aichi michiru censoredcreampiebig titsMDBKbazookarakudaMDBK-146MDBK146h-1496mdbk00146
    • 2020-12-17
    120 min

    [PPPD-891]My Girlfriend's Stepsister Seduced My Creampie With Her Big Tits Rika Aimi

  • rumi tadami censoredcreampiebig titsPPPDoppaiPPPD-891PPPD891pppd00891
    • 2021-01-18
    51 min

    IDJS-033 Reiko

  • amateur censoredamateurblowjobidjsidjs-033idjs033idjs-033
    • 2021-01-25
    99 min

    [SPRBD-043]戸惑いのラストピース/中山琴葉

  • censoredSPRBDintec incSPRBD-043SPRBD043h-706sprbd00043
    • 2021-02-02
    42 min

    FC2PPV 1657568 [Personal shooting] Tomohame! I took a gonzo like a friend ☆ Rikako 28 years old ☆

  • amateur uncensoredfc2
    • 2021-02-06
    244 min

    [DVDMS-629]Ordinary Guys & Girls Caught On Camera - College Girl Amateurs Only - Platonic Friends Build Up To 20 mL Of Pent-Up Cum Behind Closed Doors! 6 - Shy College S*****t Amateur Babes Give Their Male Friends Handjobs, Jerk Them Off With Fles

  • censoredcreampiebig titsDVDMSdeep sgreenhouse effectDVDMS-629DVDMS629dvdms00629
    • 2021-02-12
    117 min

    [YAKO-023]Skinny Girl

  • censoredamateurbeautiful girlYAKOmercuryshinjuku undergroundYAKO-023YAKO023h-1133yako00023
    • 2021-02-17
    49 min

    FC2PPV 1689875 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] ♥♥ ️ Super beautiful! Raw Gonzo to Kita 〇 Keiko girls ♥ ️ Massive vaginal cum shot! !! ♥ ️ * Review benefits / Glans Zubozubo Blow

  • amateur uncensoredfc2
    • 2021-03-22
    169 min

    [MADV-506]A College Girl From A Prestigious Institution Is Working A POV Part-Time Job Her First Consecutive Creampie Fuck Fest

  • mitsu hirose mochizuki censoredbig titssquirtingMADVcrystal eizomaniac crystalMADV-506MADV506madv00506
    • 2021-04-04
    79 min

    300MAAN-641 [Geki Erotic Layer / Hentai Propensity / Creampie 3 Barrage] Individual shooting negotiations for a beautiful girl JD who is addicted to the swamp of cosplay → I have shot every corner of her who is very excited to be seen ♪ Slender nice

  • amateur censoredcreampieamateurmaanmaan-641maan641300maan-641
    • 2021-04-15
    240 min

    [NASH-492]Guys And Girls Fired Up For Passionate Fucks - Tongues Entwined Intimately While They Mate 4 Hour BEST Collection

  • censoredcreampiemarried womanNASHpinknadeshikoNASH-492NASH492nash00492
    • 2021-04-21
    56 min

    FC2PPV 1780847 [Until half price 4/25] 2980pt → 1490pt [Creampie] [Squirting] Fresh body of the first year of working people ♥ Excited by the well-processed dick

  • amateur uncensoredfc2
    • 2021-04-30
    52 min

    FC2PPV 1795505 * Weekend limited 3980⇒2980pt ★ First 3P ♥ I love Ochinchin! Etsuko-chan, a beautiful erotic girl, 23 years old ☆ Natural bristle pussy ♥ Lust for the first W blowjob ♥ Gachi raw squirrel continuous vaginal cum shot ♥ * With special be

  • amateur uncensoredfc2
    • 2021-05-14
    48 min

    285ENDX-344 Big Tits, Fair-skinned and Good Head! What’s more, I love SEX and I’m not satisfied with it even though I’ve been doing it many times!

  • amateur censoredcreampiebig titsendxendx-344endx344285endx-344
    • 2021-06-01
    55 min

    HEYZO 2536 My Soaked Female Colleague Made Me Become Horny! – Eri Saeki

  • eri saeki uncensoredcreampieheyzo
    • 2021-06-01
    106 min

    [STARS-359]An Early Summer Special! Squirting Squirts! Breaking News She's Been Spasming The Entire Time While On The job, Squirting All The Way, And Even While Pissing Herself, Female Announcer Yuna Ogura Continues To Read The News As If Everyth

  • yuna ogura censoredsquirtingsingle workSTARSsod createyuji sakamotoSTARS-359STARS3591stars00359
    • 2021-06-04
    47 min

    230OREC-785 A-chan

  • amateur censoredcreampieuniformorecorec-785orec785230orec-785
    • 2021-06-10
    244 min

    [CVDX-452]Saliva Overflowing - A Lotion That Will Make Your Cock Melt!! Enjoy The Cumming Paradise With The Titty Fuck And Handjob Of A Mature Women Smelling Of Sticky Aloe - 30 Shots, 4 Hours

  • censoredmature womanhandjobCVDXcenter villageCVDX-452CVDX452h-086cvdx00452
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-19
    45 min

    H0930 ki210620 Mami Okuda 31years old

  • amateur uncensoredh0930
    • 2021-07-02
    226 min

    [HUNTB-046]Wearing Clothes That Are Loose and Baggy Will Make Your Tits Hang Out!! Drip Drip Drip...Maybe She Is Really Showing Her Tits On Purpose？

  • censoredcreampiehandjobHUNTBhuntermorikihhh groupHUNTB-046HUNTB046huntb00046
    • 2021-07-08
    83 min

    [REBD-568]Yura 6: Swaying And Fresh - Yura Kano

  • yura kanno censoredREBDrebeccariverREBD-568REBD568h-346rebd00568
    • 2021-07-19
    26 min

    FC2PPV 1929481 Limited Price Up To 500 Pieces! !! [Uncensored] Appeared In That Super Popular Youtuber Video! !! !! The First Yokohama Date With A Neat And Busty Lady! Creampie In Beautiful Cherry-Colored Genitals! !! (Part 2)

  • amateur uncensoredfc2
    • 2021-07-20
    181 min

    [STARS-404](3 Rounds Of Incredible, Orgasmic Sex With An Erotic Woman In Her Forties) SODstar Mariko Sada 42 Years Old Deflowering The Unrivaled Eroticism Of An Adult Woman

  • mariko sada censoredmature womansingle workSTARSsod createeasy matsumotosod starSTARS-404STARS4041stars00404
    • 2021-07-23
    123 min

    FC2PPV 1935583 Celebration! Extra 10,000 Followers Commemorative Extra! [No Individual Shooting, Fcup Beauty Witch, Shocking Ntr Exposure] It Is A Shocking Content That Can Not Be Written In The Title. Affair-Related Catastrophic Past 1 Egg Demon Ntr

  • amateur uncensoredfc2
    • 2021-07-27
    120 min

    [SAN-011]I Let My Manager With The Big Dick Fuck Me At My Part Time Job -Shion Nagisawa

  • nagisawa shion censoredcreampiebig titsSANmothermother motherSAN-011SAN011h-796san00011
    • 2021-08-19
    54 min

    FCP-035 [Delivery Only] It’S Bad If You Get Caught! Secretly Close Contact Erotic Play In The Futon! ♯2

  • amateur censoredamateurbeautiful girlfcpfcp-035fcp035fcp-035
    • 2021-08-21
    135 min

    [NSFS-020]The Boss And His Subordinate"s Wife 15: My Wife Was Taken Down By My Respected Boss! Yuri Sasahara

  • yuri sasahara censoredsingle workdramaNSFSnagae styletomitake taroNSFS-020NSFS020nsfs00020
    • 2021-09-02
    75 min

    533NNS-001 Mecha Kawagal ♪ No Squirting Rubber Creampie Punipuni Chubby Thick Pussy Sperm Flow! !! ♪ Suddenly At The Namahame Photo Session, Continuous Lively Intense Squirrel ♪ Mochi Continuous Vaginal Cum Shot W

  • amateur censoredcreampieamateurnnsnns-001nns001533nns-001
    • 2021-09-06
    53 min

    292MY-496 Uehon Nozomi 2

  • amateur censoredcreampiemarried womanmymy-496my496292my-496
    • 2021-09-10
    99 min

    529STCV-012 Nanami-Chan (18)

  • amateur censoredcreampieschoolgirlstcvstcv-012stcv012529stcv-012
    • 2021-09-24
    47 min

    FC2PPV 2242100 Appearance! !! Limited Number! [Uncensored] The Mother Of That Super Popular Pure Innocent Beautiful Girl. The Voice Echoes In The Housing Complex After Committing A Busty Bristle Woman Of Fcup … The End Of A Nympho Beauty Who Fee

  • amateur uncensoredfc2
    • 2021-09-24
    39 min

    FC2PPV 2242238 [FC2 Limited Delivery, 3P] Two Dad Friends Of The Nursery School Cum Inside The Nursery School Teacher Who Is Entrusting Their Children

  • amateur uncensoredfc2
    • 2021-10-21
    20 min

    FC2PPV 2362328 A Large Amount Of 3 Consecutive Shots Without A Blow Job At Vijiho. Three Men With Different Personalities And Occupations Are Squeezed Out With Reliable Tech (As A Matter Of Course, Please Do A Cleaning Blow, Double Satisfaction) ☆ Mi

  • amateur uncensoredblowjobfc2
    • 2021-10-21
    483 min

    [FCDSS-017]A Shaved Pussy of a Beautiful Girl with a Super-Minimum Big Breasted Baby Face! A Perfect Compilation of the Best 8 Hours of the First Experiences of Mayoi Arisaka.

  • arisaka mayoi censoredbeautiful girlslutFCDSSfalenofaleno starFCDSS-017FCDSS0171fcdss00017
    • 2021-10-27
    32 min

    FC2PPV 2377360 Prefectural Ordinary Course ③ Weekly ○ First Gonzo With A Uniform Gal Having Sex

  • amateur uncensoredfc2
    • 2021-11-06
    121 min

    [UMSO-421]I Became A Divorcee Single Father When My Wife Ran Out On Me, But Suddenly I"m A Hot Item!？ The Neighborhood Mothers Were Sympathetic Towards Me, And Wanted To Help Out, So I"ve Been Committing Adultery With Them In The Afternoons v

  • censoredcreampieamateurUMSOk m produceumanamiUMSO-421UMSO421umso00421
    • 2021-11-25
    113 min

    [NTRD-096]Netralese, My Best Friend And My Mother, Cuckold Case Study, Mayu Suzuki.

  • suzuki mayu censoredmature womansingle workNTRDtakara eizokouji takarashintokaiNTRD-096NTRD09618ntrd00096
    • 2021-12-01
    111 min

    396BIG-117 Minami Tsumugi (Narita Tsumugi)

  • amateur censoredcreampieschoolgirlbigbig-117big117396big-117
    • 2021-12-16
    67 min

    413INST-192 [Healthy Beauty] Futsal Circle Female College Student 19’s Ultra-Fine Body Shaking And Begging For Vaginal Cum Shot Many Times! Outflow From Sports Girls’ Sexual Desire Sex Saffle [Gachi] (Natsu Tojo)

  • amateur censoredcreampieamateurinstinst-192inst192413inst-192
    • 2022-01-08
    146 min

    [QRDG-002]Extremely Underground Everything You Wanted To Know About The Hotly Rumored Fresh Face Queen! Raw, Forbidden Acts That Take Place In A Locked Room, From Start To Finish Romance

  • censoredanalQRDGqueen roadQRDG-002QRDG002qrdg00002
    • 2022-02-11
    56 min

    498DDH-070 [If You Call An Esthetician To Your House …] A Sexy Sister With Big Breasts That Is Out Of The Standard Comes And She Is At Her Own House, But She Looks Like A Suspicious Person. For Some Reason, Her Sister Also Repeats Mysterious Mov

  • amateur censoredcreampiebig titsddhddh-070ddh070498ddh-070



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download