high 260




FC2CHRVSDABNNPJABWAUKGPREDADNVENXSQTESSISAUKSEBODHZGDSANFSDSSHDKAATIDMEYDPPPDWAAA

2020-12-24
113 min

[JRZE-016]Entering The Biz At 50! Ran Mizawa

  • ran misawa censoredcreampiemature womanJRZEcenter villagekotaro misatojurakuJRZE-016JRZE016h-086jrze00016
    • 2020-12-27
    120 min

    [BIJN-191]The Documentary She's Baring Her Instinct To Fuck And Enjoy Orgasmic Sex A Tall And Beautiful Married Woman Moans And Groans In Mind-Blowing Orgasmic Pleasure Kotono Nanasaki

  • kotono nanasaki censoredcreampiesingle workBIJNbijin majo emmanuelleBIJN-191BIJN191bijn00191
    • 2021-01-01
    138 min

    [SKSK-041]The Best Lover In History - Compensated Cheating E-Cup Amateur, Young Wife Chinatsu Chinatsu Asamiya

  • chinatsu asamiya censoredcreampiebig titsSKSKprestigesukesukeSKSK-041SKSK041118sksk00041
    • 2021-01-08
    93 min

    [OKP-075]Those Jiggling, Wiggling Titties Will Make Any Man Go Bad!! Divine Marshmallow-Soft Big Tits Galore Umi Mitoma God Granted This Lolita Babe A Plump Body And We Dressed Her Up In A School Swimsuit And Bloomers And A Micro Bikini, And Her Big

  • umi mitsumata censoredsingle workbukkakeOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-075OKP0751okp00075
    • 2021-01-16
    240 min

    [HUNBL-029]Girls G*******ged In Their Own Homes By Intruders Until They Stop Resisting - Made To Take Creampie After Creampie

  • censoredcreampieHUNBLhunteraldebaranhhh groupHUNBL-029HUNBL029hunbl00029
    • 2021-01-25
    52 min

    FC2PPV 1659353 [First cock 2 simultaneous blowjob ❤ complete appearance] Fcup big breasts girl reappears ☆ Masturbation while blowjob handjob w Oil slimy massage & shrimp shaving with finger man torture Dirty beauty big tits Tayun Tayun! With Ful

  • amateur uncensoredfc2
    • 2021-01-29
    61 min

    FC2PPV 1662148 Only now 980pt [First shot first cum shot] Gravure Shinozaki ● Love super similar !! 20 years old Geki Kawa baby face busty female college student and raw squirrel cum shot SEX, further reinsert and scrape sperm

  • amateur uncensoredfc2
    • 2021-02-18
    119 min

    [OKSN-318]Awakened On An Adultery Trip By A Huge Cock - Stretched To Her Limit And Pounded Right Down To Her Womb, Addicted To Pleasure After Just One Night

  • censoredOKSNabc mousouzokuokasan.comOKSN-318OKSN318oksn00318
    • 2021-03-06
    72 min

    FC2PPV 1715049 Limited to 100 Immediate deletion available ★ First shot premiere ☆ President’s daughter living in Kansai ♥ Menhera beautiful girl Chizuru-chan 22 years old ☆ Over 2000 spear people ♥ Extreme tech blowjob ♥ Raw squirrel cum shot a

  • amateur uncensoredfc2
    • 2021-03-12
    68 min

    [YMDS-023]Street Corner Snapshot #TokyoMaskBeauties (Miku 22 Years Old Freelancer)

  • censoredamateurYMDSmomotaro video publishinghimrockyoung peachYMDS-023YMDS023ymds00023
    • 2021-03-25
    93 min

    [OKB-108]Big, Plump Asses - Godly Panties - Mitsuki Nagisa - Chubby Barely Legal Beautiful Girl In Sports Briefs And Athletic Wear With Bikini Line, Pussy Hair, And Slut Exposed - Incredible Close-Ups Of All Her Hairy Holes! Then Get An Assjob, Cloth

  • scooping censoredbukkakeOKBpersonal photography of fathergod bulmaOKB-108OKB1081okb00108
    • 2021-03-28
    58 min

    [490FAND2-1]れん 1

  • amateur censoredbig titsamateurfand2fand2-1fand21490fand2-1
    • 2021-04-01
    243 min

    [NACX-076]Sexy Poses Sticking Their Asses Out! Doggy Style Only Video Collection 50 Women vol. 02

  • inaba tsugumi morimoto censoredbig titsNACXplanet plusshichidomeNACX-076NACX076h-237nacx00076
    • 2021-04-01
    64 min

    FC2PPV 1750238 [No / piece] First shot ♥ "I was a virgin until recently" A 21-year-old slender girl with short hair unveiled an innocent Gonzo for the first time! !! * There is an appearance review privilege

  • amateur uncensoredfc2
    • 2021-04-03
    41 min

    H4610 ori1753 Erika Inaga 23years old

  • amateur uncensoredh4610
    • 2021-04-03
    49 min

    210AKO-423 MAYUMI

  • amateur censoreduniformamateurakoako-423ako423210ako-423
    • 2021-04-09
    120 min

    [MIAA-423]I Live Right Next Door... If I Gave You A Blowjob, Would You Keep It A Secret From Your Girlfriend？ Seduced By My Neighbor With A Shocking Blowjob Until My Balls Are Drained Dry... Yumi Saeki ka

  • yuka saeki censoredblowjobslutMIAAmoodyzsuisei akaieveryone s porn starMIAA-423MIAA423miaa00423
    • 2021-04-10
    125 min

    [BACN-026]Step Niece Runs Away With Her Step Uncle Mirai Soragawa

  • mirai sorakawa censoredslutsingle workBACNbaltanusubashisuicandyBACN-026BACN026bacn00026
    • 2021-04-17
    119 min

    [HND-975]She Can't Keep Pretending To Be Pure! Former C***d Actress Has Her First Creampie On Camera Ryona Hisaka

  • ryona hisaka censoredcreampieblowjobHNDhon nakatiger kosakaiHND-975HND975hnd00975
    • 2021-04-19
    20 min

    FC2PPV 1777111 2800pt → 1200pt [Individual shooting, 3P second half] Seriously covered with pregnancy juice without any help to the violently rampaging meat stick! Two strange sticks are inserted many times that the husband has never done, and finall

  • amateur uncensoredfc2
    • 2021-04-19
    98 min

    [PRBYB-073]An Adorable Body Sayaka Otoshiro

  • censoredbig titsbeautiful girlPRBYBprecious beautyPRBYB-073PRBYB073h-706prbyb00073
    • 2021-04-21
    35 min

    492JCHA-015 Well, I’m always picking up

  • amateur censoreduniformschoolgirljchajcha-015jcha015492jcha-015
    • 2021-05-01
    64 min

    324SRTD-0224 I Can’t Stand It Should Be Just An AV Interview And Insert A Runaway Student!

  • amateur censoredbig titsamateursrtdsrtd-0224srtd0224324srtd-0224
    • 2021-05-22
    241 min

    [XRLE-003]Full And Huge! Thick Meaty Women With Huge Tits 240 Minutes

  • rika goto shizuka omori censoredXRLEreal worksreal real worksXRLE-003XRLE003xrle00003
    • 2021-05-29
    118 min

    [AUKG-512]Uninvited Lesbian Lovers Who Live Together - I Went To A Social Mixer And Struck Out, But On My Way Home, I Met A Beautiful Girl With Big Tits And Took Her Home - Airi Sato Saeko Hiiragi

  • airi sato hiiragi saeko censoredlesbianbeautiful girlAUKGu krentoAUKG-512AUKG512aukg00512
    • 2021-06-08
    242 min

    [SDMM-092]Reverse One-Way Mirror Cab Part 7 - Unattainable Flight Attendant Edition - Have You Ever Seen An International Airline Stewardess Take It Raw？ She Cums Hard No Matter How Many People Could Be Watching! 4 Hours, 4 Girl Compilation

  • censoredamateurSDMMsod createafro takahashimagic mirrorSDMM-092SDMM0921sdmm00092
    • 2021-06-27
    59 min

    200GANA-2512 Seriously Nampa, first shot. 1654 Picking Up A Kind And Nice Blonde White Gal! Excited and desperate for a bristle lewd gap that does not look good on the face! Sensitive Oma ● Ko repeats medium alive many times …

  • amateur censoredamateurganagana-2512gana2512200gana-2512
    • 2021-07-06
    201 min

    [STARS-386]Estacy. "I want to drown in pleasure" MINAMO Extra-large Newcomer (Masturbate with Overwhelming 4K Images!)

  • minamo censoredblowjobbeautiful girlSTARSsod createeasy matsumotosod starSTARS-386STARS3861stars00386
    • 2021-07-10
    47 min

    C0930 ki210710 Reiko Hayami 43years old

  • amateur uncensoredc0930
    • 2021-07-11
    65 min

    300NTK-603 [Procession maker Gachikawa signboard girl x sensitive treasure x super high sensitivity = Han’s dream! !! ] Even though it is a tapioca shop, a long line of male customers makes a long line of beautiful & too cute signboard girls

  • amateur censoredcreampieamateurntkntk-603ntk603300ntk-603
    • 2021-07-17
    152 min

    [CAWD-257]DMJD (A Reader Model College Girl) This Skinny Babe Is Getting Skewered By Big Thick Cocks And Sending Her AA-Cup Titties Twitching And Trembling Into Cum Crazy Ecstasy! Her Super Thin Body, Her Beautiful Legs, And Her Ultra Tight Pussy Are

  • hitomi hoshitani censoredcreampiesingle workCAWDkawaiiCAWD-257CAWD257cawd00257
    • 2021-07-18
    239 min

    [OKAX-757]A Beautiful Mature Woman With A Private Massage Room Is Sexy And Horny For Her Age! Can You Fuck Her Free Of Charge？ 4 Hours

  • censoredmature womanOKAXk m producedick mandokuokazuOKAX-757OKAX757okax00757
    • 2021-08-23
    66 min

    498DDH-029 100 Repeat Rate! Excessive Service Of Sexy Veteran Beauticians! Oil Slimy Nipple Torture X Crawl On All Fours → 60 Minutes Full Course That Keeps Ejaculating With Continuous Vaginal Detox!

  • amateur censoredcreampiebig titsddhddh-029ddh029498ddh-029
    • 2021-08-24
    154 min

    [STARS-419]I Shared A Room With A Rugby Team Member And Was Fucked By Him For Two Days And One Night In The Middle Of Summer Mio Mashiro

  • mio mashiro censoredbeautiful girlsingle workSTARSsod createakai suiseisod starSTARS-419STARS4191stars00419
    • 2021-08-26
    107 min

    [SPRD-1452]So Much Better Than My Husband... Chisato Shoda

  • shota chisato censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1452SPRD145218sprd01452
    • 2021-08-26
    73 min

    515BTGL-016 (23)

  • amateur censoredcreampiebig titsbtglbtgl-016btgl016515btgl-016
    • 2021-08-28
    64 min

    SIRO-4605 [First shot] [Slender beauty] [Beautiful Momojiri] Discovered a beautiful receptionist with high quality parts in a delicate body. The more wrinkles are drawn between her eyebrows, the more the shocked body of the big cock falls to the bott

  • amateur censoredsquirtingamateursirosiro-4605siro4605siro-4605
    • 2021-08-30
    73 min

    [HYPN-050]

  • censoredcreampiebig titsHYPNsod createdazai chinpomind controlHYPN-050HYPN0501hypn00050
    • 2021-09-01
    120 min

    [NACR-454]Confinement And Influence: I Was Disciplined By My Brother-in-law - Akane Shiki

  • akane shiki censoredcreampieblowjobNACRplanet plussakura ninshichi ku ryuuNACR-454NACR454h-237nacr00454
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-23
    125 min

    [SPRD-1462]Surrogate Mother Yuri Honma

  • really censoredcreampiemature womanSPRDtakara eizousumineko sanpeialeddinSPRD-1462SPRD146218sprd01462
    • 2021-09-23
    122 min

    [GS-405]Overly Erotic College S*****t Is Too Sexy For The Dad Who Wants To Fuck Her

  • censoredcreampieGSsosoru garcontanburaGS-405GS4051gs00405
    • 2021-09-30
    83 min

    355OPCYN-185 Kanna (Shiori Hirai)

  • amateur censoredamateuropcynopcyn-185opcyn185355opcyn-185
    • 2021-10-01
    120 min

    [HODV-21611]My Husband Doesn"t Ever Want To Fuck Me, Now My Terrible Younger CEO At Work Takes Me In For Dominant Sex. NTR Cheating Scenario. Mizuki Yayoi

  • mizuki yayoi censoredcreampiebig titsHODVh m pvotomsHODV-21611HODV216115642hodv21611
    • 2021-10-06
    59 min

    541AKYB-006 Maho (23) SSS Class! G Cup Beauty ♪ ​​(Hono Wakamiya)

  • amateur censoredcreampiebig titsakybakyb-006akyb006541akyb-006
    • 2021-10-16
    110 min

    [BIJN-209]THE Document Bare Instinctive Climax Cum SEX Tall Bitch GAL Nasty Creampie Mad Climax Isshiki Ayaba

  • isshiki ayaba censoredcreampiesingle workBIJNbijin majoBIJN-209BIJN209bijn00209
    • 2021-10-23
    240 min

    [BDSR-463]Of Course They Will Get Fucked!？ Creampie Bitch Wife Swap - 14 People, 4 Hours

  • censoredcreampieamateurBDSRbigmorkalbanderas takedabig mocalBDSR-463BDSR46357bdsr00463
    • 2021-11-03
    54 min

    230OREC-921 Reina (Reina Usami)

  • amateur censoredamateurcosplayorecorec-921orec921230orec-921



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download