high 141




FC2KBINACXAPODMARAAWDMEYDVEMACAWDADNNATRSPRDSDABBLKPPPDSHKDEBODHDKAJULSANCESD

2020-12-10
120 min

[FSDSS-141]A Hot Goddess Who Has Cum Down To The Beach Suzume Mino This Divine Babe Is Hitting Amateur Boys With Reverse Pick Up Action And Hunting For Cocks!

  • suzume mino censoredbig titsamateurFSDSSfalenomachado hanyufaleno starFSDSS-141FSDSS1411fsdss00141
    • 2020-11-22
    149 min

    [CAWD-141]Huge Dick x G-Spot Arousal x Big Squirting Making This Luxurious Body Pulse With An Internal Vagina Orgasm Yui Amane

  • amane yui censoredsquirtingbeautiful girlCAWDkawaiisuisei akaiCAWD-141CAWD141cawd00141
    • 2020-11-20
    240 min

    [MGDN-141]Lower Halves On Display In The Dressing Room! Pranks On MILF Clerks - 240-Minute Special

  • censoreduniformblowjobMGDNstar paradisemegadonMGDN-141MGDN141h-254mgdn00141
    • 2020-11-13
    171 min

    [MDBK-141]All Nude All Shaved High School: My Infamous School Days Getting A Sweet Private Sex Lesson From My Sexy Fully Nude Teacher With Big Tits

  • yoshine yuria nana matsumoto censoredcreampiebig titsMDBKbazookarakudaMDBK-141MDBK141h-1496mdbk00141
    • 2020-11-07
    240 min

    [YLWN-141]Pleasure Of Multiple Play In Which Married Women Drown

  • censoredYLWNyellow moonpappan tateishiYLWN-141YLWN141ylwn00141
    • 2020-11-04
    136 min

    [GVH-141]Anal Dirty Talk VII - Nozomi Arimura

  • arimura nozomi censoredanalslutGVHglory questaida yumenoGVH-141GVH14113gvh00141
    • 2020-10-23
    129 min

    [ECB-141]Hunting Cherry Boys In Their Homes - Mitsuki Nagisa

  • scooping censoredbeautiful girlslutECBwaap entertainmentkurumi ichinosecobra warpECB-141ECB1412ecb00141
    • 2020-09-21
    118 min

    [AVSA-141]A Usually Proper Wife Cant Say No To A Fucking Turns Out To Be A Masochist Woman Who Loves To Fuck Yuka Hirose

  • yuka hirose censoredsquirtingmature womanAVSAavs collector shiroyuki kimuraavscollector sAVSA-141AVSA141avsa00141
    • 2020-09-08
    121 min

    [SDAB-141]Strong Sexual Desire. Asuka Momose SOD Exclusive AV Debut

  • momose asuka censoredamateurbeautiful girlSDABsod createtiger kosakaione s youthSDAB-141SDAB1411sdab00141
    • 2020-05-30
    63 min

    [ETQR-141][Daydream POV] Obsessed Stepsis's Intense Acts Of Sluttery! Aida Usagi

  • aika usagi censoredcreampiebeautiful girlETQRerotic timeETQR-141ETQR141h-1186etqr00141
    • 2020-05-01
    96 min

    [SGA-141]The Greatest Creampie Sex, With The Greatest Lover 55 Begging For Creampie Sex A Horny, Slutty Office Lady

  • censoredcreampieamateurSGAprestigeno directorsnow moon flowerSGA-141SGA141118sga00141
    • 2020-03-22
    129 min

    [BLOR-141]She Can Talk About Anime For Hours And She Also Hides A Huge Pair of Tits! This Bubbly Nerd Girl Takes It To The Hilt Until Her Legs And Hips Are Twitching From Non-Stop Cumming

  • censoredbig titsBLORbroccoli mousouzokubroccolibroccoliBLOR-141BLOR141blor00141
    • 2020-03-09
    138 min

    [BACN-017]Dirty Story Of 141 cm Tiny Loli Girl Fucks Masochist Men As Their Queen. Sena Ninomiya

  • sena ninomiya censoredcreampiesingle workBACNbaltandaibutsu yoshidacandyBACN-017BACN017bacn00017
    • 2020-02-22
    239 min

    [YTR-141]Kotone Toua Gets Fucked For 4 Hours Straight

  • toua kotone censoredcreampiedeepthroatYTRnonno directorno labelYTR-141YTR141h-127ytr00141
    • 2020-02-22
    115 min

    [JUL-141]To My Surprise, This Unfaithful Housewife Made A Double Booking And Then, My Plan For Plunder Began Minori Kawana Aoi Mukai

  • real village henan ai mukai censoredcreampiemature womanJULmadonnaeitaro hagaeJUL-141JUL141jul00141
    • 2020-01-31
    120 min

    [HZGD-141]Tempting Husband's Employee With Kissing And Huge Tits Into Creampie Cheating Fuck Tomoe Nakamura

  • tomoe nakamura censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-141HZGD141h-1100hzgd00141
    • 2020-01-25
    159 min

    [JUFE-141]Dirty Talking Babe Only Has Eyes For Me: Waka Cuckolds Me To Please My Perverted Nature (Waka Misono)

  • misono waka censoredbig titsslutJUFEfitchyumeno aidaJUFE-141JUFE141jufe00141
    • 2019-11-09
    117 min

    [IPX-402]117 Orgasms! 141 Spasms! 8,100 ccs Of Squirting! Breaking Past The Upper Limit Of Eros Company Lust A Trance Orgasmic Fuck Minami Aizawa

  • minami aizawa censoredsquirtingbeautiful girlIPXidea pocketinabartissueIPX-402IPX402ipx00402
    • 2019-10-27
    109 min

    [HIKR-141]We Went Nampa Hunting In Los Angeles And Found A Horny Married Woman Who Was Deprived Of Sex And When We Asked Her To Perform Some Masturbation She Looked Like She Was Down To Fuck, So We Gave Her A Promise Not To Ever Tell Her Husband And

  • censoredamateurHIKRhigh kara mousouzokusaburo hollywoodHIKR-141HIKR141hikr00141
    • 2019-10-22
    130 min

    [STARS-141]Bonded Suzu Honjo

  • suzu honjo censoredcreampiesingle workSTARSsod createkaorusod starSTARS-141STARS1411stars00141
    • 2019-10-10
    118 min

    [MEKO-141]Married Woman Who Took A High Paying Part Time Job As A Nude Art Model Fucked And Filled With Cum 04

  • censoredcreampieamateurMEKOmature woman laboMEKO-141MEKO141h-1160meko00141
    • 2019-10-03
    120 min

    [NKKD-141]During A 2-Day, 1-Night Business Trip To The Northern Kanto Region, In Order To Save Costs, This Orgasmic Employee Was Forced To Share A Twin Bed Room With His Lady Boss Kaho Imai

  • natsuho imai censoredmature womansingle workNKKDjet eizoNKKD-141NKKD141nkkd00141
    • 2019-09-12
    125 min

    [HONB-141]A Gal Bitch Who Will Give Blowjob Action In Park Bathrooms Hina Nanase

  • hina nanase censoredcreampieblowjobHONBmercurythe first shibuya special force headquarHONB-141HONB141h-1133honb00141
    • 2019-08-31
    147 min

    [MIAA-141]Underarm Sensuality Suffocating Armpit Ecstasy Mikako Abe

  • abe mikako censoredsingle workMIAAmoodyzhatatai ryoeveryone s porn starMIAA-141MIAA141miaa00141
    • 2019-08-10
    150 min

    [EYAN-141]The Perfect Tits! A Girl From The Countryside With Incredible Bell-Shaped H-Cup Tits! Airi Mikumo Is A Young Wife With The Tits Of A Goddess, Getting Them Squeezed, Shaken, Covered Up And Revealed In Her Porno Debut - This Is An Absolute Mu

  • airi mikumo censoredbig titssingle workEYANe bodywives of hanasagariEYAN-141EYAN141eyan00141
    • 2019-06-22
    179 min

    [MISM-141]Mind-blowingly Good Anal Sex! Submissive Pervy Girls With Shaved Pussies Love Taking It In The Ass! Rui Hizuki

  • rui hizuki censoredanalcreampieMISMm girls labshura jinMISM-141MISM141mism00141
    • 2019-05-31
    122 min

    [JJPP-141]Peeping Video Shows Prettyboy Bringing Mature Woman Home For Fuck. Only On FANZA! Pre-Release Special! 74

  • censoredcreampiemature womanJJPPjukujo japanJJPP-141JJPP141jjpp00141
    • 2019-05-17
    83 min

    [VOSS-141]I Would Always See This Beautiful Married Woman (I Could Tell Because Of Her Wedding Ring) On The Morning Crowded Train, And I Had A Crush On Her, But When I Saw Her Being Attacked By A Molester, Instead Of Resisting, She Was Cumming, So I

  • censoredcreampiemature womanVOSSvenuskaniethe matures projectVOSS-141VOSS141voss00141
    • 2019-04-04
    120 min

    [PRED-141]"Don't Blame Me If You Get Pregnant" Orgasmic Creampie Special Featuring A Former Announcer For A Local TV Station! Yuka Arai

  • yuka arai censoredcreampiebig titsPREDpremiumsapporo taroelegancePRED-141PRED141pred00141
    • 2019-03-06
    150 min

    [GDHH-141]She Sends Her Sex Toys To My Place! My Childhood Friend Is Really A Dirty Girl! She Says "My Parents Will Get Mad If They Find Out!" So She Sends The Sex Toys She Buys Online (Egg Vibrator, Vibrator, Electric Massager, Aphrodisiac)

  • censoredschoolgirlGDHHgolden timekiteretsuhhh groupGDHH-141GDHH141gdhh00141
    • 2019-01-21
    141 min

    [GENT-141]This 180cm Tall Married Woman Is Like An Erotic Goddess, And She's My Very Own Creampie Pussy Hole! [A Short Dude Is Ejaculating Inside Her Pussy Until She Gets Pregnant!] Sae 29 Years Old

  • censoredcreampiemature womanGENTgentle man mousouzokugentleman mousouzokuGENT-141GENT141gent00141
    • 2018-11-07
    245 min

    [YMDD-141]The Slut Wagon Is Cumming!! Happening-A-Go-Go!! A Strange Journey With Mihina Nagai And Liz

  • azumihina nagai mihina censoredcreampiesquirtingYMDDmomotaro eizolisewakamomoYMDD-141YMDD141ymdd00141
    • 2018-09-30
    131 min

    [BIJN-141]This Woman's Passion For Pleasure Is Awesome, As She Continuously Cums To Heaven, Spasms Endlessly, And Defiles Herself Completely, So We Injected This Young Wife With So Much Consecutive Creampie Cum She Was Certain To Get Pregnant! Mi

  • mika aikawa censoredcreampiesingle workBIJNbijin majo emmanuelleBIJN-141BIJN141bijn00141
    • 2018-06-28
    240 min

    [WSP-141]We're Defiling This Beautiful Mature Woman We Met Today With Our Semen... 2

  • kaho kasumi yuki god censoredbukkakeWSPwaap entertainmentupdatingWSP-141WSP1412wsp00141
    • 2018-06-22
    253 min

    [BAZX-141]Total Domain: Knee-high maniacs 2

  • censoredcreampieschoolgirlBAZXmedia stationone topbazookaBAZX-141BAZX14161bazx00141
    • 2018-03-18
    161 min

    [SSNI-141]Akiho Yoshizawa Is Getting Defiled And Fucked In A Full Body Cum Facial Lotion Lathered Massive Bukkake Rape

  • akiho yoshizawa censoredbeautiful girlsingle workSSNIs1 no 1 stylexavier thomasSSNI-141SSNI141ssni00141
    • 2017-10-21
    150 min

    [MIAE-141]A Big Tits Dirty Talk Slut Body Bursting Out Of Her Competitive Swimsuit Misaki Honda

  • honda cape censoredbig titsslutMIAEmoodyzkyoseimoodyz acidMIAE-141MIAE141miae00141
    • 2017-10-15
    259 min

    [OYC-141]Two Young Country Girls in Tokyo for University Drink Too Much at a Party and End Up in a Game of Truth or Dare Dirtier than They've Ever Experienced Before!

  • censoredOYCoyashoku.companymatildahhh groupOYC-141OYC141oyc00141
    • 2017-06-23
    200 min

    [YRH-141]100 Negotiation! Rumored Extremely Cute Show-Girl x PRESTIGE PREMIUM 03

  • censoredbig titssquirtingYRHprestigeyorozu honpoYRH-141YRH141118yrh00141
    • 2016-11-02
    241 min

    [HFD-141]Wanna Get Off With Me, Mister？

  • aya akiyama censoredHFDdreamticketHFD-141HFD14124hfd00141
    • 2016-06-12
    125 min

    [XVSR-141]The School Of Lust Suzu Harumiya Aya Misaki

  • harumiya suzu misaki aya censoredbig titsschoolgirlXVSRmax asono kancalenXVSR-141XVSR141xvsr00141
    • 2015-02-08
    104 min

    [VEC-141]My Boss' Wife Is Too Hot... Yukari Orihara

  • yukari orihara censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-141VEC141vec00141
    • 2014-12-14
    117 min

    [HND-141]This Busty Office Slut Will Teach You How To Give Her A Creampie Miyu Kotohara

  • ryo arimori miyu tokohara censoredcreampiebig titsHNDhon nakamiyoshi rusherHND-141HND141hnd00141
    • 2014-09-07
    446 min

    [MIRD-141]MOODYZ Fan Thanksgiving Day - Fuck Bus Tour 2014 - Large Orgies In The Tropics On The Fuck Bus!

  • ai uehara bud censoredcosplayMIRDmoodyzmohikarumoodyz realMIRD-141MIRD141mird00141
    • 2014-08-09
    120 min

    [MIDE-141]Elder Sister's Tempting Panty Shots! Yui Nishikawa

  • yui nishikawa censoredbeautiful girlslutMIDEmoodyzmoodyz divaMIDE-141MIDE141mide00141
    • 2014-04-13
    117 min

    [SNIS-141]Give Me Cum Yui Aoba

  • yui aoba censoredbeautiful girlsingle workSNISs1 no 1 styletakuanSNIS-141SNIS141snis00141
    • 2014-01-25
    148 min

    [WANZ-141]Chosen By The Fans! I Want to do that with Tsubomi.

  • bud censoredcosplaybeautiful girlWANZwanz factorywanzWANZ-141WANZ1413wanz00141
    • 2013-06-27
    151 min

    [IPZ-141]Secret Female Investigation Arisu Miyuki

  • miyuki alice censoredsingle workIPZidea pockettakuandishIPZ-141IPZ141ipz00141



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download