high 089




FC2MEYDCESDDTTAWDADNFSDSSMILKPPPDPREDAVSANACRCJODVEMAHDKAMARAKBIDASDGVHLULUCHRV

2020-09-27
59 min

413INST-056 Rino Chii 19 Sai ☆ JD 1 year of pigmented intense Russian body & puffy nipple born in snow country ♪ Tsui abandoned otaku girl who masturbates with erotic doujinshi with a real raw dick and a gun thrust piston ♪ Congratulations on a l

  • amateur censoredcreampieamateurinstinst-056inst056413inst-056
    • 2020-10-03
    112 min

    390JAC-062 [* Browsing attention * Brain alive metamorphosis JD x 4 vaginal cum shot] Ultimate different dimension FUCK Bomb here! Whole body clitoris college student gets acme and spree! Iku with word blame! Iku with air nipple licking! Iku with sig

  • amateur censoredcreampieamateurjacjac-062jac062390jac-062
    • 2020-10-11
    116 min

    [BAHP-052]AV Footage Tricking The Kinda Girls Who You'd Like To Fuck! Rika Yamamoto Continually Climaxes, Overwhelming Her Sensitive Body

  • yamamoto renka censoredblowjobsingle workBAHPbaltanminimal iwamurahoppinBAHP-052BAHP052bahp00052
    • 2020-10-11
    123 min

    [MIBM-004]Glossy Pantyhose 5 COSPLAY Fetish - Yuria Kano

  • yulia kano censoredbig titscosplayMIBMmilumil silverMIBM-004MIBM004mibm00004
    • 2020-10-24
    53 min

    1Pondo 102420_001 Welcome To Luxury Spa: Maina Ito Marina Sato

  • amateur uncensored1pondo
    • 2020-10-25
    180 min

    [EYS-058]Hidden SEX Shooting With One Of My Mom's Friends Who Likes To Take Care Of Me

  • censoredcreampiebig titsEYSstudio i sEYS-058EYS058eys00058
    • 2020-10-31
    44 min

    279UTSU-462 Miyusan

  • amateur censoredmarried womanamateurutsuutsu-462utsu462279utsu-462
    • 2020-11-01
    136 min

    [NKD-262]Eating Up Little Women - Yui Natsuhara

  • yui natsuhara censoredsingle workNKDnakajima kogyokanamoriNKD-262NKD262nkd00262
    • 2020-11-06
    115 min

    [PARATHD-3043]Would You Light Up Mao Hamasaki 's Pussy With A Vibrator？ A Sightseeing Tour Of Tokyo And She's Horny The Whole Time

  • hamazaki mao censoredsingle workPARATHDparadise tvPARATHD-3043PARATHD3043parathd03043
    • 2020-11-14
    60 min

    SIRO-4336 [First shot] [Miracle beauty nude] [Hentai talent] A fair-skinned beautiful girl who has just grown up participates in the war. The perfect body that is attracted greedily seeks pleasure .. Application amateur, first AV shooting 172

  • amateur censoredsquirtingamateursirosiro-4336siro4336siro-4336
    • 2020-11-20
    104 min

    [SPRBD-039]I Like You, But/Nao Yuki

  • censoredbig titsbeautiful girlSPRBDintec incSPRBD-039SPRBD039h-706sprbd00039
    • 2020-12-04
    71 min

    [DHT-219]Picking Up A Married Woman And Making Her Cum With A Creampie - Miya, 31 Years Old

  • censoredcreampiebig titsDHThot entertainmentyen ikkiDHT-219DHT21959dht00219
    • 2020-12-04
    62 min

    417SRCN-057 [G cup neat office lady] A neat and clean beauty who is generously exposed on the stairs outside the company! My full erection Ji ● Po excited by her bold exposure masturbation is grasped with an erotic hand ….

  • amateur censoredcreampiebig titssrcnsrcn-057srcn057417srcn-057
    • 2020-12-05
    147 min

    [PRED-273]Fresh Face Our Latest Exclusive Star Pristine Body Blessed By Nature. Watch A Shy, Good Girl Make Her Porn Debut Mami Sakurai

  • mami sakurai censoredsquirtingblowjobPREDpremiummichiru arashiyamaelegancePRED-273PRED273pred00273
    • 2020-12-25
    45 min

    [DHT-236]CAR SEX DRIVE - Yurie Yamano, 43 Years Old

  • censoredamateurmature womanDHThot entertainmentshungoDHT-236DHT23659dht00236
    • 2020-12-25
    128 min

    [ECB-143]Loving 2 Shots - Sara Ryuboku

  • uryuki sara censoredblowjobbeautiful girlECBwaap entertainmentkurumi ichinosecobra warpECB-143ECB1432ecb00143
    • 2020-12-31
    14 min

    FC2PPV 1627035 [Prevention of body baldness, Gonzo] Pretty young Lorirea G cup busty girls in uniform and vaginal cum shot

  • amateur uncensoredfc2
    • 2021-01-01
    141 min

    [URKK-034]After A Month Without Sex, I Plowed My Best Friend's Girlfriend For 24 Hours! She Made Me Come With Incredible Cowgirl Sex And I Gave Her My Creampie! Ruka Inaba

  • inaba censoredcreampiebig titsURKKunfinishedrolandone milk of soulURKK-034URKK034urkk00034
    • 2021-01-09
    169 min

    [JUFE-248]I Ordered A Delivery Heath Call Girl Who Didn't Allow Real Fucking, And My Plain Jane And Shy Colleague From The Business Affairs Department Came Over... Starting Today, I'm Going To Make This Bitch My Raw Big Tits Sex Toy Rina Asuk

  • asuka riina censoredcreampiebig titsJUFEfitchJUFE-248JUFE248jufe00248
    • 2021-02-06
    83 min

    [ADN-289]How To Make A Lonely Married Woman Fall - Kanna Misaki

  • kanna misaki censoredsingle workdramaADNattackerssayaka dateotona no dramaADN-289ADN289adn00289
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    64 min

    10musume 021221_01 Amateur work: I’m a clerk at a shipping company Narumi Kawasaki

  • amateur uncensored10musume
    • 2021-02-17
    70 min

    279UTSU-492 Riho-san

  • amateur censoredbig titsmarried womanutsuutsu-492utsu492279utsu-492
    • 2021-03-04
    58 min

    FCP-002 [Delivery only] Completely subjective! !! G cup or more that completely wraps Ji ● Ko … Superb big tits fucking ＃ 2

  • amateur censoredbig titsamateurfcpfcp-002fcp002fcp-002
    • 2021-03-04
    86 min

    [HIMA-092]I Love My Stepmom And Now She's Getting Remarried Miyuki Aoyama

  • miyuki aoyama censoredcreampiemarried womanHIMAcenter villageshibuyahanazono center villageHIMA-092HIMA092h-086hima00092
    • 2021-03-12
    35 min

    FC2PPV 1722707 [No first shot vaginal cum shot] 140 minutes suddenly 2 packs Sober Loriko is a 20-year-old claw I tried to vaginal cum shot to that child who was an adult in the class w [Personal shooting]

  • amateur uncensoredfc2
    • 2021-03-25
    121 min

    [RCTD-391]Dirty Talking Female Anchor, 25 Years Old: A Female Announcer With Crazy Habits SP - Sei Maihara

  • kiyoshi maihara censoredbig titssingle workRCTDrockettaro kanbeRCTD-391RCTD3911rctd00391
    • 2021-03-26
    240 min

    [NASH-477]Adultery - Wives' Family Fun -

  • censoredmarried womanmature womanNASHpinknadeshikoNASH-477NASH477h-067nash00477
    • 2021-03-30
    129 min

    [STARS-355]"Stop It, Dad..." This Young Wife Can Never Tell Her Husband About The Way Her Twisted Father-In-Law Makes Her Drown In The Pleasure Of French Kisses And Guilty Fucks Yuna Ogura

  • yuna ogura censoredsingle workdramaSTARSsod createryo inugamisod starSTARS-355STARS3551stars00355
    • 2021-04-02
    111 min

    483SGK-020 [Impact problem work] [* Handling caution] [G milk horny beast monster] [Iki crazy lunch key 4P] [Continuous vaginal cum shot] [Actually a solid bank clerk] Everyone, this time is really an incident! !! Shocking problem work Bomb! Invasion

  • amateur censoredcreampiebig titssgksgk-020sgk020483sgk-020
    • 2021-05-02
    67 min

    FC2PPV 1799155 Dropout with one experienced person. She is originally a minimum beautiful girl in the third grade of active duty. She has a large amount of vaginal cum shot while being hurt by the first blowjob in her life and a tiny pussy in the mid

  • amateur uncensoredfc2
    • 2021-05-04
    60 min

    499NDH-015 Look! This is the final strong monster created by Hakata! From the greedy Paipanma Co ○ who does not want to be pulled out once inserted, the tide that breaks the camera is Bashabasha www long time SEX welcome! !! !! Rather, I want to keep

  • amateur censoredcreampiebig titsndhndh-015ndh015499ndh-015
    • 2021-05-07
    159 min

    [MUDR-147]Y********l Is Enthralled With Men's Crotches... Impregnation Party Aoi Nakajo

  • nakagusuku censoredcreampieschoolgirlMUDRmukuMUDR-147MUDR147mudr00147
    • 2021-05-12
    40 min

    FC2PPV 1814759 Until 19 1480 [None] A gal with a good fair-skinned style of a high-flying car. Threatened with force and vaginal cum shot on a dangerous day.

  • amateur uncensoredfc2
    • 2021-05-21
    114 min

    FC2PPV 1829216 Congratulations ♪ Consecutive top acquisition ☆ 彡 [5980pt → 1980pt until 5/23] ♥ Sales No. 1 daughter ♥ Total length 1 hour 54 minutes [Appearance] [Nothing] [No ◎ Slope system] Premier with unreleased video completely recorded Edition

  • amateur uncensoredfc2
    • 2021-05-29
    66 min

    SIRO-4493 [First shot] [High-spec beauty] [Overwhelming legs] The obscene death that Madonna in the company who can also work fascinates. When her weaknesses are intensively blamed, she expresses pleasure with a cute voice, and when her beautiful fac

  • amateur censoredamateursirosiro-4493siro4493siro-4493
    • 2021-06-03
    79 min

    435MFC-112 [God Constriction x Demon Iki Climax] Gonzo SEX with "Mio" who has a high deviation value body with cuteness of idol class! Although it is embarrassing to be taken, it cums continuously with a violent piston! Once the erotic switch

  • amateur censoredcreampieamateurmfcmfc-112mfc112435mfc-112
    • 2021-06-04
    160 min

    [PRED-315]Super Slut Harem Beautiful Women Surrounded Me And Made Me Cum Inside Of Them Over And Over! Ai Hoshina Kurea Hasumi Hibiki Otsuki AIKA

  • sena ai hasumi claire censoredcreampieslutPREDpremiumtrendy yamaguchielegancePRED-315PRED315pred00315
    • 2021-06-19
    155 min

    [JUL-614]Seduced By My Mother-In-Law Who's Always Hungry For My Big Dick Marina Shiraishi

  • rena shiraishi censoredbig titsmature womanJULmadonnakogoro kindaichiJUL-614JUL614jul00614
    • 2021-06-25
    117 min

    [MIMK-090]K**ling Time With My Niece - Live Action - Nana Yagi

  • nana yagi censoredsquirtingbeautiful girlMIMKmoodyzdragon nishikawamankitsuMIMK-090MIMK090mimk00090
    • 2021-06-26
    97 min

    [VENX-051]A Stepson Became A Practice Dummy For His Stepmom Who Decided To Work At A Soapland - Rio Ohara

  • osamu osamu censoredcreampiebig titsVENXvenuskaniefakecest winntersVENX-051VENX051venx00051
    • 2021-07-08
    190 min

    [HAWA-252]We Slipped An Amateur Married Woman One Condom And Gave Her A Night At Home With A Regular College Guy. But Once Is Never Enough, So She Let Him Creampie Her Cunt Twice! Meet Nanao: A 40-Something Married Woman With H-Cup Tits Who Likes To

  • censoredbig titsmature womanHAWAkosumosu eizoumountain moricosmospictures soft on demandHAWA-252HAWA2521hawa00252
    • 2021-07-22
    83 min

    FC2PPV 1935720 [9980 → Limited Number 2980] First And Last Complete Appearance ❤️ Intellectual Beauty Working At The Reception Of The Clinic ❤️ Big Explosion Of Libido Hidden In The Mind And Body ❤️ Put Out A Lot … ❤️ Creampie In The Vagina Of A

  • amateur uncensoredfc2
    • 2021-07-31
    136 min

    [FLAV-277]The Sexy Amateur Women In Masks Have Plump, Colossal Tits And Big Asses, And They Are Sluts Who Gratify Our Sexual Desires

  • censoredamateurFLAVdigital arkdigital ark dejitarua kuFLAV-277FLAV277flav00277
    • 2021-08-06
    124 min

    [MIAA-482]Training Camp G*******g - Cute Female Manager Takes A Creampie From Every Member Of Her Team Until Her Pussy Gushes Cum Natsu Tojo

  • natsu tojo censoredcreampiedeepthroatMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-482MIAA482miaa00482
    • 2021-09-05
    61 min

    Caribbeancom 090521-001 Creampie With An Ideal Mistress Beautiful Big Breasts Beauty Every Day Mika Sumire

  • mika sumire uncensoredcreampiecaribbeancom
    • 2021-09-05
    106 min

    [LOL-199]Y********l Specialty. Rough Sex From Step-father During Hellish Hot Springs Vacation With Masochistic Girl. Ten Hasumi

  • hasumiten censoredcreampiebeautiful girlLOLglayzrori senkaLOL-199LOL19912lol00199
    • 2021-09-09
    143 min

    [GUN-757]Vibrator Masturbation With Super Small Swimsuits 2

  • karen anba marina saito censoredsquirtingGUNradixsakuraba kyuu kokoro otokobatsugunGUN-757GUN757433gun00757



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download