haruka takami




FC2HNDVEMAAUKSSANNACRCHRVMARAPPPDSQTESSNISSISCAWDMILKRBDSDABSHKDMIAAAUKGSTARSJUFE

2020-10-09
115 min

[PARATHD-3013]Picking Up Girls In The City "Show Us Your Shaved Pussy" Deluxe Edition - They Were So Willing We Asked Them For Sex Too!

  • censoredamateurPARATHDparadise tvPARATHD-3013PARATHD3013parathd03013
    • 2020-10-17
    119 min

    [SSNI-895]Relaxed Older Step-Sister Doesn't Wear Panties In Summer! Defenseless Temptation Amin Nina

  • new name amin censoredbeautiful girlsingle workSSNIs1 no 1 stylebungo maedaSSNI-895SSNI895ssni00895
    • 2020-11-07
    239 min

    [MLSM-033]Top Class Hot Mature Highlights Chisato Shoda 4 Hours, Voluptuous Beauty! 2

  • shota chisato censoredcreampiebig titsMLSMmellow moonMLSM-033MLSM033mlsm00033
    • 2020-11-10
    52 min

    Caribbeancom 111020-001 Blowjob Maid Services : Let Me Clean Your Cock, Sir! Moe Osaki

  • moe osaki uncensoredcreampiehandjobcaribbeancom
    • 2020-11-15
    36 min

    FC2PPV 1571544 [Uncensored] [Appearance] [Mobile shooting] Translated Ali Married woman with a silver wig and forced Gonzo SEX ♡

  • amateur uncensoredfc2
    • 2020-11-19
    120 min

    [SYKH-018]Natural Airhead Beautiful Tits Infidelity: Dirty Semen Wife, Rina 27 Years Old

  • censoredmarried womanmature womanSYKHleisure mrs emanielSYKH-018SYKH018sykh00018
    • 2020-11-23
    153 min

    [ANZD-051]Maid Cafe Waitress Riri (20) Loves Sperm - Kinky Slut Who Wants Cum Facials All Over Her Glasses - She Swallows 9 Loads

  • censoredamateurbukkakeANZDapricot mousouapricotANZD-051ANZD051anzd00051
    • 2020-11-27
    69 min

    [SHMO-169]Virgin Love / MISAO

  • misao censoredSHMOorustak softSHMO-169SHMO169
    • 2020-11-29
    158 min

    [MRSS-100]The Teacher's Wife Was Assigned To Teach The DQN Bad Boys Who Destroyed Our Class Aina Shinkawa 7

  • aishin shinkawa censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-100MRSS100mrss00100
    • 2020-12-03
    479 min

    [CADV-794]Crystal Films 35th Anniversary - Triple Lesbian 8-Hour Special

  • yuki misa ayako kano censoredsquirtinglesbianCADVcrystal picturecrystal exCADV-794CADV79449cadv00794
    • 2020-12-05
    236 min

    [HUNTA-927]"No, Wait... You Promised You Wouldn't Put It In! You Said Just Grinding..." While Dry Humping My Super Serious Classmate She Got All Wet And I Slipped Right In! Rawdogging & Creampie!

  • censoredcreampieschoolgirlHUNTAhhh groupmorikihunterHUNTA-927HUNTA927hunta00927
    • 2020-12-12
    165 min

    [IPX-579]My Girlfriend Was Waiting For Me At Home But I Missed The Last Train And Had To Spend The Night At My Coworker's Place... She Was So Sexy In Her Loungewear With No Underwear That I Couldn't Resist Her And We Wound Up Banging All Nigh

  • anna kami censoredblowjobslutIPXidea pocketbungo maedadishIPX-579IPX579ipx00579
    • 2020-12-17
    148 min

    [SSNI-951]Orgasm Special - Real Life Non-Nude Erotic Model Akua Yamazaki Gets Fucked

  • mizuyama yamazaki censoredbig titsbeautiful girlSSNIs1 no 1 stylekyoseiSSNI-951SSNI951ssni00951
    • 2020-12-21
    11 min

    Caribbeancom 122120-001 Pussy Encyclopedia : Kana Takashima

  • kana takashima uncensoredcaribbeancom
    • 2021-01-08
    190 min

    [NHDTB-477]Tomboy Groper - Cool, Collected Girls Made To Cum Until They Lose Their Composure And Give In To Getting Fucked Like Bitches

  • censoredsquirtingNHDTBnatural highitaka smith rimpounderNHDTB-477NHDTB4771nhdtb00477
    • 2021-01-21
    66 min

    10musume 012121_01 Fucked and Cum Inside The Girl Who Got Completely Drunk

  • amateur uncensored10musume
    • 2021-02-17
    33 min

    [sika-034]明日香 2(27)

  • amateur censoredcreampieamateursikasika-034sika034sika-034
    • 2021-02-20
    99 min

    [YSN-540]This Plain Jane Temporary Worker With Big Tits Is Hooked On Cocks Because She's A Meat-Eating Maso Bitch With A Screw Loose, And Loves To Suck Dick So Much That The Entire Stuff Is Scared Shitless Of This Crazy Cunt (LOL) Chinatsu Asamiy

  • chinatsu asamiya censoredcreampiebig titsYSNnonYSN-540YSN540h-127ysn00540
    • 2021-02-28
    109 min

    [RD-1041]Hot Older Wife Impregnated By Father In Law On Purpose Fifty Something Married Woman Gets Seduced By The Neighbor On The Same Day She Moves In

  • namiki touko ryo fukutomi censoredmarried womanblowjobRDathena videomurayamaathenaRD-1041RD1041149rd01041
    • 2021-03-10
    47 min

    FC2PPV 1720002 Limited number [Individual shooting] Prefectural Commercial Department ② Innocent fair-skinned tennis girl. Gonzo after school

  • amateur uncensoredfc2
    • 2021-03-12
    152 min

    [SCPX-420]She Quit Her Job To Have A Happy Marriage, But I Found Out That My Former Colleague Was Now A Sex Worker! She Was The Bright Light Of Our Office, And I Always Wanted To Fuck Her, And Now This Is My One Big, Special Free Chance!!

  • censoredcreampieblowjobSCPXscoopmousouzokuSCPX-420SCPX420h-565scpx00420
    • 2021-03-12
    86 min

    SNYZ-022 Rin-chan 2 (Maria Ousawa)

  • amateur censoredamateurcosplaysnyzsnyz-022snyz022snyz-022
    • 2021-03-13
    240 min

    [HJMO-455]Best Friends Face Off! Fixed Dildo Hip Grinding Contest, They Can't Go Home Until They Grind 1000 Times!! 9

  • censoredsquirtingHJMOhajime kikakujohan yuanHJMO-455HJMO455hjmo00455
    • 2021-03-17
    49 min

    492MERC-282 Aggressive Enkou Rokkotachi

  • amateur censoredcreampieuniformmercmerc-282merc282492merc-282
    • 2021-03-25
    77 min

    435MFC-092 A Beautiful Big Tits Young Wife Who Has An Affair SEX With A Former Boyfriend Even Though It Is A Wedding Next Week [Gonzo ＃ Hina ＃ 26 Years Old ＃ G Cup (Married Woman)]

  • amateur censoredcreampiebig titsmfcmfc-092mfc092435mfc-092
    • 2021-03-26
    118 min

    [WAAA-043]Horny Wife Shows Off Her Body In A Slutty Swimsuit At The Public Pool So That Men Will Oggle Her Hikari Sena

  • hikari sena censoredbig titsslutWAAAwanz factorywanzWAAA-043WAAA043waaa00043
    • 2021-03-30
    69 min

    326PAPA-029 [Daddy activity x minor x Saddle tide injection] [Two consecutive shots in the mouth & vagina] Professional-grade daddy activity girls advent who are making a rough profit with a father killing blowjob! Unauthorized vaginal cum shot to

  • amateur censoredcreampiesquirtingpapapapa-029papa029326papa-029
    • 2021-04-03
    134 min

    [PKPL-004]Young Wife Cuckholding Documentary G-Cup Adulterous Wife Misato Toyosaki

  • toyosaki misato censoredcreampiebig titsPKPLfuck group and fun friends daydreamersPKPL-004PKPL004pkpl00004
    • 2021-04-14
    132 min

    [OVG-169]"Hey, I'm Bored, So Can I Fuck You？" This Little Devil Is So Horny, She Started Fucking Other Guys, And Once She Was Satisfied, She Got Them Ejaculating, While Her Boyfriend Was Busy Playing Video Games

  • kana morisawa kanako iioka heart vegetables rio censoredblowjobslutOVGglory questOVG-169OVG16913ovg00169
    • 2021-05-01
    110 min

    [ADN-310]Dear, Forgive Me... Desire To Be Ravished Reiko Kobayakawa

  • kobayakawa reiko censoredsingle workdramaADNattackersnagira kenzootona no dramaADN-310ADN310adn00310
    • 2021-05-04
    63 min

    Caribbeancom 050421-001 Nymphomania: drowning in sperm HITOMI

  • hitomi uncensoredcreampiebukkakecaribbeancom
    • 2021-05-07
    93 min

    [OKK-026]Ayumi Manaka - Glistening, Gorgeous Bodies In A Slippery Snug Competitive Swimsuit - Enjoy An Adorable Barely Legal Babe! Peeping In The Change Room: From Flat Chests To Big Tits, Shaved Pussy To Full Bush, And Extreme Armpit Close-Ups - Plu

  • ayumi aika censoredbeautiful girlsingle workOKKpics dmm co jpgodly swimming raceOKK-026OKK0261okk00026
    • 2021-05-08
    138 min

    [CEMD-004]I Raised A Sex Doll Who Will Do Whatever I Want Vol 2 Yuri Sakura

  • cherry blossom censoredbig titsmature womanCEMDceleb no tomoCEMD-004CEMD004cemd00004
    • 2021-05-15
    121 min

    [JKNK-117]A 50-something Mature Woman Who Cums Repeatedly When Her Nipples Are Toyed With

  • rieko hiraoka orie maya censoredmature womanJKNKjuku no kura emmanuellejuku no kuraJKNK-117JKNK117jknk00117
    • 2021-05-18
    139 min

    [STARS-364]Sirently Ravished - You Can't Make A Sound... You Can't Tell A Soul While She Rides You And Whispers In Your Ear, Then Makes You Cum. Mahiro Tadai

  • mahiro yui censoredbeautiful girlslutSTARSsod createhideyuki shinboSTARS-364STARS3641stars00364
    • 2021-06-04
    233 min

    [HUNTB-024]"Please Stop! I Can't Stand It Anymore!" Once You Know Her Secret (A Lady Boss, A Nurse, My Friend's Girlfriend ...) You Can Insert A Remote Vibrator Into Her Pussy And Watch Her Twitch And Tremble With Spasmic, Massively P

  • censoredcreampieHUNTBhuntermorikihhh groupHUNTB-024HUNTB024huntb00024
    • 2021-06-19
    240 min

    [REXD-368]If You Let Me Nail Your Wife, You Won't Get Fired... Desperate Husbands Up For Restructuring Let Their Bosses Have Their Way

  • censoredcreampieREXDredmanji groupREXD-368REXD368rexd00368
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-25
    12 min

    FC2PPV 1870786 [4K] Overwhelming Feratech! Moe-chan’s Big Cock Swallowing Cum Blow Personal Shoot

  • amateur uncensoredfc2
    • 2021-06-25
    48 min

    FC2PPV 1855276 [Personal shooting] Misuzu 32 years old, a large amount of vaginal cum shot to a bewitching lewd beautiful wife with outstanding style

  • amateur uncensoredfc2
    • 2021-07-06
    34 min

    493NAEN-083 Creampie in a black gal! ？？ De M! ？？ Massive ejaculation in the vagina by poking a huge tits gal with a big cock Kaho Imai

  • amateur censoredamateurbeautiful girlnaennaen-083naen083493naen-083
    • 2021-07-16
    57 min

    FC2PPV 1925947 Half Price Of New Work During The Sale Period !! [No / Piece] Gonzo Of Exotic Super Slender Beauty! The Gun Thrust With A Big Cock Is Too Pleasant And The Last Is A Face Collapse Ww * There Is A High Quality Review Privilege

  • amateur uncensoredfc2
    • 2021-08-21
    56 min

    C0930 tk0041 Miki Tsunai 26years old

  • amateur uncensoredc0930
    • 2021-09-10
    136 min

    [ROE-007]A Lady Boss And Her Fresh Face Employee A Creampie Lovers" Contract, Filled With Drool And Bodily Fluids Yumi Narisaki

  • grace narisaki censoredcreampiebig titsROEmadonnaunicorn fukudamonroeROE-007ROE007roe00007
    • 2021-09-23
    26 min

    FC2PPV 2241339 Unauthorized Vaginal Cum Shot To A Beautiful Ass Young Wife

  • amateur uncensoredfc2
    • 2021-09-29
    78 min

    259LUXU-1451 Luxury TV 1463 A Beautiful Female Doctor (Proctology) In Her Second Year Of Marriage Appears On AV! Marital Relationship Is Good, But Sex Is Normal And Unsatisfactory! "I Want To Live With All My Strength …" A Beautiful Wife

  • amateur censoredmarried womanamateurluxuluxu-1451luxu1451259luxu-1451
    • 2021-10-01
    120 min

    [MIAA-508]"I"m Not Letting You Go Home Today Store Manager" They Fuck In Secret After The Store Closes And She Made Me Come Over And Over Riho Fujimori

  • riho fujimori censoredcreampiebig titsMIAAmoodyztakarase hironoriminna no kikatanMIAA-508MIAA508miaa00508
    • 2021-10-15
    121 min

    [MEYD-711]A Good Deed Toward A Snake Pays Off. This Otherworldly Blowjob Slut Has A Snake Tongue For Endless French Kissing Creampie Fucking That Goes Till Morning. Yumi Saeki ka

  • yuka saeki censoredcreampiebig titsMEYDtameike gorokindaichishougo rouMEYD-711MEYD711meyd00711



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download