futaba




FC2MARAAUKGHDKABBANCHRVMIDEABWAMBINNPJADNMIAASSISAWDHMNSSNIATIDMILKSQTEDASDSPRD

2021-01-01
60 min

328HMDN-325 [Oni cock 3Px married woman] G cup married woman who is fallen into a meat hole by men Celebrity wife who completely falls with intense pleasure and seeding acme to taste with fierce 3P “I don’t care anymore! 【amateur】

  • amateur censoredcreampiebig titshmdnhmdn-325hmdn325328hmdn-325
    • 2021-01-04
    48 min

    FC2PPV 1631980 ☆ First shot ☆ Complete appearance ☆ Frustrated beauty OL gave her boyfriend the first Gonzo in Naisho ♥ I shot a lot to the back of the vagina ♪ [With review benefits]

  • amateur uncensoredfc2
    • 2021-01-08
    243 min

    [MGT-131]Pickin Up Amateur Girls On The Street! Vol. 98 - Poolside Pickups 2020 1

  • censoredsquirtingamateurMGTprestigemegatraMGT-131MGT131118mgt00131
    • 2021-01-12
    100 min

    [HONB-203]A Lovely, Sexy Gal Who Lets Me Do Her Every Time She Stops By My House To Make A Delivery

  • censoredbig titsamateurHONBmercurythe first shibuya special f e headquarHONB-203HONB203h-1133honb00203
    • 2021-01-24
    125 min

    [GENM-071]Vivid POV - She'll Do Anything To Pay Her Bills Suzu Ayano

  • ayano suzuju censoredsingle workGENMgenekig 3GENM-071GENM071genm00071
    • 2021-02-05
    482 min

    [PPT-105]Minamo Nagase 8-Hour BEST PRESTIGE PREMIUM TREASURE Vol. 03 - All 6 Titles By "Minamo Nagase" Permanently Preserved In This Collector's Edition!

  • minase nagase censoredcreampiebig titsPPTprestigeprestige premium treasurePPT-105PPT105118ppt00105
    • 2021-02-06
    125 min

    [JUL-458]A Married Woman In The Beauty Department A Madonna Exclusive No.2!! She's Lifting Her Creampie Ban!! A Stepmother And Stepson Have Lost Their Minds In The Brutal Heat, And When He Cums Home For A Visit, They Engage In Sweaty Creampie Sex

  • hiyori aso censoredcreampiebig titsJULmadonnaunicorn fukudaJUL-458JUL458jul00458
    • 2021-02-06
    55 min

    Caribbeancom 020621-001 My Wife Misa Makise

  • misa makise uncensoredcreampiehandjobcaribbeancom
    • 2021-03-12
    42 min

    FC2PPV 1723082 ★★ Blow mania must-see ★ Layer release that I wanted to appear on my own ★ Playing with a sensitive body and letting go of acme cum ★ Creampie Gokkun cleaning Blow Kupa fully open SEX ★

  • amateur uncensoredfc2
    • 2021-03-25
    135 min

    1Pondo 032521_001 Ryu Enami : Ryu Enami Special Edition

  • amateur uncensored1pondo
    • 2021-03-26
    118 min

    [WAAA-043]Horny Wife Shows Off Her Body In A Slutty Swimsuit At The Public Pool So That Men Will Oggle Her Hikari Sena

  • hikari sena censoredbig titsslutWAAAwanz factorywanzWAAA-043WAAA043waaa00043
    • 2021-03-26
    244 min

    [MFCC-009]MOON F***e CHEERS Sucking Collection. vol. 9

  • censoredcreampieamateurMFCCprestigemoon force cheersMFCC-009MFCC009118mfcc00009
    • 2021-03-26
    45 min

    359TYVM-141 Plump Glamor Young Wife Portio Cum Squirting Sex! !!

  • amateur censoredcreampiebig titstyvmtyvm-141tyvm141359tyvm-141
    • 2021-04-04
    67 min

    SIRO-4453 [First shot] [Slender beauty] [Bounce your body up to the geki piss ..] A slender beauty who learns calligraphy at art school appears. Distort the face as well as her model with pleasure and flush the whitening naked body .. AV application

  • amateur censoredamateursirosiro-4453siro4453siro-4453
    • 2021-04-08
    130 min

    [NHDTB-516]痴●師に電車の隅でこっそりイラマされ顔面えずき汁まみれで泣き寝入りする女子○生

  • censoredNHDTBnatural highkansukeNHDTB-516NHDTB5161nhdtb00516
    • 2021-04-14
    49 min

    FC2PPV 1768690 Nana-chan, a beautiful busty college girl who feels too much! Sixth! The second anal raw squirrel! !!

  • amateur uncensoredfc2
    • 2021-05-08
    89 min

    [VENX-037]Step Mother Seduces Her Step Son By Getting Up Close And Whispering To Him So Her Husband Doesn't Find Out Yu Shinoda

  • shinoda yu censoredcreampiemature womanVENXvenuskaniefakecest winntersVENX-037VENX037venx00037
    • 2021-05-14
    141 min

    [ROYD-056]The Dorm Mom's Daughter Was Completely Defenseless When She Came In To Help With The Sex-starved Male Dorm. Airi Momose

  • momose airi censoredcreampieschoolgirlROYDroyalkoichi davidsonhhh groupROYD-056ROYD056royd00056
    • 2021-05-31
    100 min

    430MMH-014 [This is milk ●●! ] Big breasts H cup that shakes in all directions! !! !! Echiechi BODY hidden in a gentle personality! Gonzo with Haru-chan, a beauty student who aims to be an esthetician ♪

  • amateur censoredbig titsamateurmmhmmh-014mmh014430mmh-014
    • 2021-06-10
    182 min

    [SVDVD-860]The Magic Mirror Number Bus Hard Boiled Take The 10,000 Yen-Per-Centimeter-To-The-Limit Dildo Challenge! At First It Started With Just The Tip Of This Super Thick Dildo ... But Then She Got Super Horny And Unexpectedly Plunged It In All Th

  • censoredsquirtinguniformSVDVDsadistic villagesushi yokubomagic mirror number sadistic villageSVDVD-860SVDVD8601svdvd00860
    • 2021-06-12
    122 min

    [SCOP-725]This Gal Was Wearing A Hoodie At Home But Not Wearing A Bra Or Panties And Totally Had Her Guard Down!! Even Though They Were StepB****************r, He Couldn't Control His Lust And In the End They Had Fakecest: Creampies Sex!! 2

  • censoredcreampiesisterSCOPscoopk taromousouzokuSCOP-725SCOP725scop00725
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-26
    69 min

    476MLA-044 Slutty Amateur 100 An All-Rounder Bitch With High Tension Who Wanders In The Night City Is A Low Erotic Hurdle!

  • amateur censoredcreampiebig titsmlamla-044mla044476mla-044
    • 2021-07-17
    122 min

    [HMN-023]Can't You Tell her What Turns You On？ So good. From my Serious Girlfriend to the Addictive Nipples of a Hardcore Tanned Slut. From Nipples to Creampies in Short Order. Ranka.

  • ranka censoredcreampieslutHMNhon nakamiyoshi rusherHMN-023HMN023hmn00023
    • 2021-07-17
    75 min

    355OPCYN-170 Rin Miyazaki Rin

  • amateur censoredcreampiemarried womanopcynopcyn-170opcyn170355opcyn-170
    • 2021-08-07
    169 min

    [SCPX-430]Teeny Tiny Micro-Bikini And Lotion Makes A Hot Amateur Cutie Blush - It Was Supposed To Be Thigh Sex But She Was So Slippery The Cock Slipped Right In! "I Said Not To Stick It In Me..." But Her Request Is Ignored And Results In A Ho

  • censoredcreampiebig titsSCPXk m producescoop kmpSCPX-430SCPX430scpx00430
    • 2021-08-12
    127 min

    [SPRD-1444]Trying To Get Pregnant By My Father-In-Law And In Secret From My Husband, Violet Mihara

  • mihara sumire censoredmature womansingle workSPRDtakara eizouhotate ikkanaleddinSPRD-1444SPRD144418sprd01444
    • 2021-08-13
    260 min

    [DVDMS-704]Spying On Ordinary Girls - A Female Office Worker And Her Two Younger Male Coworkers Stay In The Same Hotel On A Business Trip, But Who Would"ve Thought They"d Be In The Same Room! One Thing Leads To Another And Soon They"re Do

  • censoredcreampieamateurDVDMSdeepsking of genkingdeep sDVDMS-704DVDMS704dvdms00704
    • 2021-08-14
    108 min

    [VEMA-168]The Teacher"s Home Visit While His Parents Aren"t Home. The S*****t And The Teacher Entangle Their Tongues Again And Again. Chisato Shoda

  • shota chisato censoredcreampiebig titsVEMAvenuspe tamegami venusVEMA-168VEMA168vema00168
    • 2021-08-17
    62 min

    SIRO-4604 [First Shot] [Climax Count Cannot Be Measured ∞] [Pleasure Absolutism] Reiwa’S Sex Beast Attacks! ？？ A Glamorous Girl Who Boasted "I Do Not Want To Do Lukewarm Sex" Goes Crazy With Full Throttle .. Application Amateur, First Av

  • amateur censoredamateursirosiro-4604siro4604siro-4604
    • 2021-09-11
    151 min

    [CHRV-139]A Medical Intern Step-Brother Who Wanted To Do "Palpations" That Involved Tit Fondling, Nipple Sucking, Finger Banging, And Sticking It In Raw Tempted By His Step-Sister"s Big Tits G-Cup 96Cm Mina

  • censoredcreampiebig titsCHRVcherries reboCHRV-139CHRV139chrv00139
    • 2021-09-11
    58 min

    H4610 ori1764 Rena Ito 22years old

  • amateur uncensoredh4610
    • 2021-09-24
    141 min

    [JUL-713][VR] Rave Review ATTACKERS Titles - Special Selection Of 16 Titles, 640 Minutes. Long Scenes Only In This Best Of Collection.

  • ai kano kazama yumi censoredbig titslesbianJULmadonnamishima rokusaburoJUL-713JUL713jul00713
    • 2021-10-01
    123 min

    [ADN-348]The Female Teacher Is Turned Into A Sex Toy Of A S*****t With Issues And Gets A Creampie Or Two, Like It Or Not, At A Love Hotel Until Morning. Iroha Natsume

  • natsume saiharu censoredcreampiesingle workADNattackersdoragon nishikawaotona no dramaADN-348ADN348adn00348
    • 2021-10-22
    141 min

    [ROE-014]Beautiful, Kind, Sexy, The Ideal G Cups Boss. Working At A Major Apparel Brand. Rumi Amano 47 Years Old JAV DEBUT.

  • rumi amano censoredbig titsmature womanROEmadonnamamezawa mametaroumonroeROE-014ROE014roe00014
    • 2021-10-22
    186 min

    [HUNTB-128]A Secrete Fakecest Threesome! Step-parents Oversee Step-siblings! These Step-siblings Become Much More During A Threesome Fakecest Sex Scenario!

  • censoredcreampiesisterHUNTBhunterlobby kunhhh groupHUNTB-128HUNTB128huntb00128
    • 2021-10-23
    130 min

    [LUKE-015]Intimate Dirty Talk That Lures A Hard Dick In Temptation As This Lewd Slut Sucks It Down For Deepthroat Action. Sumire Tamba

  • niwa sumire censoredbig titsslutLUKEdigital arkdigital ark dejitarua kuLUKE-015LUKE015luke00015
    • 2021-10-28
    132 min

    [SPRD-1472]The Truth Is ... My Wife ... Has Been Getting Fucked By My Father And My Big Brother ... Ren Usui

  • usui ren censoredmature womansingle workSPRDtakara eizoutakara hiroshialeddinSPRD-1472SPRD147218sprd01472
    • 2021-10-29
    112 min

    [SHKD-975]I Have My Favorite Weather Girl Here At My Home, In Confinement, So I Can Have Creampie Sex With Her Every Day. Hikari Ninomiya

  • hikari ninomiya censoredcreampiesingle workSHKDattackerssada oka sadaoshi yoru akuSHKD-975SHKD975shkd00975
    • 2021-11-01
    122 min

    [AMBI-143]Three Days With Unrelated Sister-in-law! Had Continuous Sex Saying "Touch Here!!" Miina Konno

  • miina konno censoredcreampiebig titsAMBIplanet plusdirector oanbibarentsuAMBI-143AMBI143h-237ambi00143
    • 2021-11-20
    53 min

    355OPCYN-206 Sarina 2 (Sarina Momonaga)

  • amateur censoredcreampiebig titsopcynopcyn-206opcyn206355opcyn-206
    • 2021-12-09
    61 min

    200GANA-2607 In The Spear Room Of The Nampa Master Of Hyakusen Renma, Bring In Sex Hidden Camera 229 Bring A Geki Ubu Daughter With One Experienced Person To The Spear Room! Gently Hug Her Who Is Ready For Her And Is In Her Acceptance System … A

  • amateur censoredamateurganagana-2607gana2607200gana-2607
    • 2021-12-11
    131 min

    [CEMD-094]I"m Sorry I Peed So Much 33 REMI

  • remi censoredsquirtingmature womanCEMDceleb no tomoCEMD-094CEMD094cemd00094
    • 2021-12-15
    29 min

    FC2PPV 2519236 Until Tomorrow! "# 18" Is Fine. I Took A Gonzo Of A Real Small Animal Student. Young Flood Pussy Feels Too Good ♡ Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-12-17
    151 min

    [MIAA-549]A Fucking Naughty And Haughty Little Bitch Gets Grabbed And Educated With Piston-Pounding Strokes Lala Kudo

  • lara kudo censoredcreampiedeepthroatMIAAmoodyzsuisei akaieveryone s porn starMIAA-549MIAA549miaa00549
    • 2021-12-23
    85 min

    [HIMA-097]My Beloved Stepmom Got Remarried Chisato Shoda

  • shota chisato censoredcreampiemarried womanHIMAcenter villageshibuyahanazono center villageHIMA-097HIMA097h-086hima00097
    • 2022-01-03
    60 min

    [SHH-033]Nozomi Haneda AV Retirement. A Lesbian"s Last Arousal. Passionate Kissing, Orgasms While Scissoring Together, Double-sided Dildo, Simultaneous Heavy Squirting.

  • nozomi haneda censoredbig titssquirtingSHHnatural highraftin maeshiroSHH-033SHH0331shh00033
    • 2022-01-08
    119 min

    [KAGP-212]The Best Sluts Can Suck Cock Without Using Their Hands! 4 10 Amateur Girls Give Blowjobs Without Using Their Hands

  • censoredamateurblowjobKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-212KAGP212kagp00212



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download