find




FC2WANZBLKGMEMVENUAUKGAUKGSSNIMVSDKSBJHMNKBISPRDAUKSMILKDASDSSISPREDMIAAFSDSSAWD

2021-01-15
120 min

[MDTM-697]Always Looking Down On Me. Galactic Beauties' Service Club - Mitsuha Higuchi vol. 002

  • mitsuha higuchi censoredcreampieuniformMDTMuchu kikakutodoMDTM-697MDTM697h-585mdtm00697
    • 2021-01-22
    44 min

    480FRIN-016 《Personal shooting / hidden shooting》 Idol class J ● Hidden shooting leaked by being put in the host

  • amateur censoreduniformamateurfrinfrin-016frin016480frin-016
    • 2021-01-22
    65 min

    FC2PPV 1644406 [Plump big breasts & erotic ass] Mirei [Individual shooting] If you put on a white garter on a saffle with a plump erotic body that is very satisfying for both breasts and ass, you will break through the limit of eroticism! Demon t

  • amateur uncensoredfc2
    • 2021-01-28
    61 min

    [SIROR-047]Rent-A-MILF - The Secret Sidegig Their Husbands Don't Know About File No. 47 -

  • censoredcreampiebig titsSIRORdispatched.comSIROR-047SIROR047h-1492siror00047
    • 2021-01-29
    72 min

    [MBRBM-013]SEX - Mai Fukuhara

  • mai fukuhara censoredbig titssingle workMBRBMspice visualMBRBM-013MBRBM0135141mbrbm00013
    • 2021-02-01
    242 min

    [NACX-071]12 Bushy-Haired Mature Woman Babes With Fluffy Pussy Hair vol. 04

  • reiko ayukawa yuki seijyo censoredmature womanNACXplanet plusnanakuruNACX-071NACX071h-237nacx00071
    • 2021-02-06
    140 min

    [HUNBL-031]He Seemed To Be A Handsome Young Man, But He Turned Out To Be A Immoral Fuck, But She Had Fallen In Love With Him, And In Order To Score Points With Him, This Prim And Proper Sch**lgirl Let The Other Teacher Assholes Use Her As A Creampie

  • censoredcreampieschoolgirlHUNBLhunteraldebaranhhh groupHUNBL-031HUNBL031hunbl00031
    • 2021-02-10
    43 min

    FC2PPV 1679611 [February limited sale] Hime-chan and above are unreasonable! Sorry for being too erotic. Immediately after being hit by a famous instrument, a large amount of vaginal cum shot is made to a pre-ketsu beauty man with fair skin! !! The f

  • amateur uncensoredfc2
    • 2021-02-10
    31 min

    FC2PPV 1680076 [With bonus video] Youkai fuck “Miss luxury soap” or “Black pussy returns” [No]

  • amateur uncensoredfc2
    • 2021-02-12
    242 min

    [UMSO-370]Sorry Daddy... Twisted Love, Lusting After His Step-daughter

  • hikaru minazuki scooping censoredmature womanUMSOkmumanamiUMSO-370UMSO37084umso00370
    • 2021-02-14
    123 min

    [NJP-001]精液私に下さい 池澤十和子

  • towako ikezawa censoredcreampiesquirtingNJPjeweljueruNJP-001NJP001h-848njp00001
    • 2021-02-19
    12 min

    FC2PPV 1693328 Rio Yukopi Tech I had him pull out with a camera while I was playing

  • amateur uncensoredfc2
    • 2021-02-23
    62 min

    SIRO-4431 [First shot] [Tall x Slender] [Beautiful face to be polluted] A general store clerk with a slender model body shows off her soft skin and participates in the war. A beautiful woman who laments “She wants a boyfriend”, even if she

  • amateur censoredamateursirosiro-4431siro4431siro-4431
    • 2021-02-28
    54 min

    HEYZO 2470 Busty Amateur Hot Girl’s Plump Body – Yu Nagata

  • yu nagata uncensoredcreampiehandjobheyzo
    • 2021-03-01
    147 min

    [HZ-006]My Masseuse Is So Hot - The Way She Moves Her H-Cup Body Is Criminal! Ena Koume

  • ena koume censoredcreampiebig titsHZplumposts gt asakusaamateurHZ-006HZ006h-113hz00006
    • 2021-03-12
    197 min

    [DSS-222]Picking Up Amateur Girls! No. 222 Loads Of Beautiful Hybrid Girls! Tokyo Alerts Version

  • censoredamateurbeautiful girlDSSmomotaro video publishingdukelady huntersDSS-222DSS222dss00222
    • 2021-03-17
    93 min

    430MMH-013 [Super God Milk! !! ] I cup soft body JD and Gonzo! !! A must-see for the muscular tight big ass and big breasts in clothes! !! 2 consecutive SEX that cums with mutual pleasure ♪

  • hana censoredbig titsamateurmmhmmh-013mmh013430mmh-013
    • 2021-04-02
    233 min

    [HEZ-266]Car Sex Challenge! Sumire Niwa / Shion Sato

  • niwa sumire sato white sound censoredmature womanHEZhot entertainmentHEZ-266HEZ26659hez00266
    • 2021-04-14
    151 min

    [SSIS-041]Dominant Slut Ichika Hoshimiya Makes Tied Up Subs Bust Their Nuts For 20 Loads

  • ichika hoshimiya censoredslutsingle workSSISs1 no 1 stylesuisei akaiSSIS-041SSIS041ssis00041
    • 2021-04-16
    242 min

    [MXSPS-663]REQUEST Beautiful Sensitive Girls Nonoka Sakino

  • sakino flower censoredbeautiful girlMXSPSmaxingMXSPS-663MXSPS663h-068mxsps00663
    • 2021-04-18
    106 min

    [GNAX-052]Over The Course Of Several Days, This Innocent Female S*****t Was Trapped And Held In Confinement And Fucked Over And Over Again Confinement Behind Bars Suzu Monami

  • monami bell censoredschoolgirlsingle workGNAXnagirakazumanagira nagiraGNAX-052GNAX052gnax00052
    • 2021-05-01
    126 min

    [NACR-421]The Beautiful Wife Next Door She Accidentally Enters The Wrong House After Partying Akari Niimura

  • akari shinmura censoredbig titsslutNACRplanet plusdirector onanakuruNACR-421NACR421h-237nacr00421
    • 2021-05-05
    56 min

    FC2PPV 1803102 GW limited 1000 yen discount ★ Regular price as soon as it runs out ★ I want you to do it again … Refrain from events one after another! !! I want you to see my cosplay and H body ★ Part 1

  • amateur uncensoredfc2
    • 2021-05-06
    86 min

    [REBD-555]Minaho Our Thanks For You Minaho Ariga

  • ariga minaho censoredsingle workREBDrebeccachikara sawamuraREBD-555REBD555h-346rebd00555
    • 2021-05-25
    44 min

    H4610 ki210525 Yuki Miki 23years old

  • amateur uncensoredh4610
    • 2021-06-05
    166 min

    [MEAT-032]Completely Unequaled! Cock Addict Piston Teacher - Chitose Yuki

  • chitose in the evening censoredbig titssingle workMEATbig fleshy road family daydreamMEAT-032MEAT032meat00032
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    78 min

    413INST-132 [Celebrity / Outflow] [Secret personal photo session] with a drama actress who likes American comics [Gonzo SEX of memories with her]

  • amateur censoredcreampieamateurinstinst-132inst132413inst-132
    • 2021-06-24
    153 min

    [FSDSS-249]Full-Body Licking Stimulates Her Erogenous Zones - She Gets Fucked 3 Times And Takes A Cum Facial - Rin Natsuki

  • rin natsuki censoredbig titsbeautiful girlFSDSSfalenomaeda tomonorifaleno starFSDSS-249FSDSS2491fsdss00249
    • 2021-07-22
    118 min

    [MIDE-958]Strong-Willed Female Boss Regains The Pussy Of Her Youth When She Wears A School Uniform For The First Time In 10 Years! A Stud Like Me Was More Than Happy To Fuck Her All Night! Mizuki Aiga

  • mizuki ai censoredcreampieuniformMIDEmoodyzzaku araimoodyz divaMIDE-958MIDE958mide00958
    • 2021-07-23
    121 min

    [XVSR-604]The Best Success: A Green Light For Unprotected Creampies!! Feeling So Good, She Comes Again and Again!!

  • ichibana mogami hana sato censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-604XVSR604xvsr00604
    • 2021-08-06
    118 min

    [IPX-701]"I Was Fucked Hard..." One After The Other... Baton- Fucked Race Queen Iyona Fujii

  • iyo fujii censoredcosplaysingle workIPXidea pocketzack araitissueIPX-701IPX701ipx00701
    • 2021-08-14
    61 min

    300NTK-623 [Big Breasts Kyaba Miss] [After Raw Sex] [Tokuno Customer Service 2 Squeezing] Big Breasts Kyaba Miss After Raw Sex With Sex! !! Dochashiko G Milk Pressure Customer Service Induces Erection Ji ○! !! Serious Positive Sexual Intercourse Of T

  • amateur censoredcreampiebig titsntkntk-623ntk623300ntk-623
    • 2021-08-27
    240 min

    [T28-604]24 Self Portraits Of Girls In Black Stocking And Masturbation Video 4 hours

  • censoreduniformbeautiful girlT28tmaT28-604T2860455t2800604
    • 2021-09-19
    27 min

    FC2PPV 2224133 Face / No ◯ Positive [Cuckold J ◯ Mami-Chan Series 2nd] Boyfriend I’M Sorry Again ★ Ntr ★ Mini Egg Girls Continuous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-10-01
    126 min

    [AMBI-139]A Devilish Step Cousin Who Will Lure My Cherry Boy Ass To Temptation With Her Big Tits Riho Takahashi

  • riho takahashi censoredcreampiebig titsAMBIplanet plusdirector oanbibarentsuAMBI-139AMBI139h-237ambi00139
    • 2021-10-14
    70 min

    OREX-305 Mao 2 (Mao Hamasaki)

  • amateur censoredcreampieamateurorexorex-305orex305orex-305
    • 2021-10-22
    240 min

    [HNDB-202]Quickies Right After Meeting! Instant Orgasms! Fucking Resumes While Her Pussy"s Still Spasming After A Creampie! "I"m Already Coming!" Ignoring Her Resistance, We Keep Fucking And Creampie-ing Her!! 4 Hours Of Continuous Or

  • mitsuki kamiya hill erina censoredcreampiebeautiful girlHNDBbookHNDB-202HNDB202hndb00202
    • 2021-10-23
    107 min

    [APNS-261]Falling For Lusty Older Men... Pure Innocent Big Tits Hottie Wet From Old Spit, Hono Konomi

  • yoshimi hono censoredcreampieschoolgirlAPNSaurora project annexnasu yukihiroAPNS-261APNS261apns00261
    • 2021-11-11
    115 min

    [DOCP-331]温泉NTR 混浴温泉でびんびんになった乳首をひたすらこねくりイカセ 彼氏が居るにも関わらず発情SEX

  • amateur censoredcreampieamateurdocpdocp-331docp331docp-331
    • 2021-12-04
    310 min

    [HOIZ-032]Cum Cum Cute #03 Amateur Cum Cum Z / Beautiful Girl / Amateur / Private Video Session / Hookup App / POV / SNS / Cum Face / 2 Ejaculations / Neat And Clean / Beautiful Tits / Big Tits / Slender / Black Hair

  • censoredbig titsamateurHOIZamateur seduction daydream familyHOIZ-032HOIZ032hoiz00032
    • 2021-12-09
    61 min

    200GANA-2607 In The Spear Room Of The Nampa Master Of Hyakusen Renma, Bring In Sex Hidden Camera 229 Bring A Geki Ubu Daughter With One Experienced Person To The Spear Room! Gently Hug Her Who Is Ready For Her And Is In Her Acceptance System … A

  • amateur censoredamateurganagana-2607gana2607200gana-2607
    • 2021-12-11
    197 min

    [CMC-266]A Collection Of The Best Fuck Ups By Beautiful, Naive Butchers Who Were Corrupted By SM Whores

  • sasaki hanasaki ian censoredCMCcinemagicjoutasu otokocollectCMC-266CMC266cmc00266
    • 2021-12-25
    119 min

    [HMNF-076]Sex Films 07

  • shiina eru iori nanase censoredbig titsblowjobHMNFhmjmcompany matsuonon fictionHMNF-076HMNF076h-172hmnf00076
    • 2021-12-31
    118 min

    [MIAA-560]D***king Bodily Fluids, Getting Squirted With Them, And Making Them Come Out All Over The Place, My Girlfriend And I Have Splashy Cohabitation Sex.

  • emperor yuzu censoredcreampiesquirtingMIAAmoodyzmichiru arashiyamaeveryone s porn starMIAA-560MIAA560miaa00560
    • 2022-01-01
    60 min

    [010122-001]Caribbean Cutie Vol.33

  • mai shirakawa uncensoredcreampiehandjobcaribbeancom
    • 2022-01-13
    130 min

    [MEKO-223]"Rental MILF" Service Returns 11 - If You Ask Nicely They"ll Let You Secretly Creampie Them - Sexy, Kindly Cougars Who Just Wanna Fuck And Cum Back For More

  • censoredcreampieamateurMEKOmature woman laboMEKO-223MEKO223h-1160meko00223
    • 2022-01-13
    93 min

    [OKK-036]Asuka Momose Wet And Shiny And Tight A Goddess In A Competitive Swimsuit We Offer You A Cute Lolita Girl In A Competitive Swimsuit For Your Viewing Pleasure! Watch Her Change In Peeping Videos, And Check Out Those Tiny Titties, Big Tits, And

  • momose asuka censoredbeautiful girlsingle workOKKdaddy s private photosgodly swimming raceOKK-036OKK0361okk00036



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download