emi fukada




FC2AUKGWAAAAVSANACXCAWDSTARSAWDHMNDASDMIDEMIDVADNGMEMHDKAGVHSANIPXABWBLKSDAB

2021-01-15
157 min

[PTYH-001]You've Gotta Kiss Until The Whole Candy Is Dissolved - But This Made Her So Excited She Wanted Creampie Sex!

  • censoredcreampieamateurPTYHpetersPTYH-001PTYH001h-021ptyh00001
    • 2021-01-19
    48 min

    FC2PPV 1650646 For a limited time [Appearance] Prefectural general course ③ Karate club beautiful girl. Dirty her uniform and pussy with sperm

  • amateur uncensoredfc2
    • 2021-01-22
    139 min

    [BFD-005]The Girl I Like Is Dating My Best Friend Rei Kuruki

  • satoshi kuruki censoreduniformschoolgirlBFDdream ticketikkyu senBFD-005BFD00524bfd00005
    • 2021-01-23
    51 min

    H4610 ori1746 Yuka Oose 23years old

  • amateur uncensoredh4610
    • 2021-02-12
    31 min

    [CLO-123]Cleavage Shots ... Her Bulging Big Tits Look So Naughty Underneath Her Clothes Haruka Koide

  • haruka koide censoredbig titsblowjobCLOchobitchchovicCLO-123CLO123h-1435clo00123
    • 2021-03-01
    214 min

    [DKSB-109]Part Time Jobs For Hot Amateurs Blowjobs And Cum Swallowing First Time D***king Cum 17 Girls

  • censoredamateurblowjobDKSBoffice k sk s bestDKSB-109DKSB10936dksb00109
    • 2021-03-02
    63 min

    SIRO-4442 [First shot] [Foolery of sticky skin JD] [Signboard girl of general store] An active female college student with an appearance reminiscent of a favorable announcer. Contrary to her neat appearance .. AV application on the net → AV experienc

  • amateur censoredamateursirosiro-4442siro4442siro-4442
    • 2021-03-05
    66 min

    [SZKK-015]My Step Sister Would Never...H

  • amateur censoredbig titssisterSZKKorustak softSZKK-015SZKK015
    • 2021-03-13
    119 min

    [MEYD-662]The Married Woman Next Door Complained Every Day About The Noises From My TV, Because I Liked To Watch Adult Videos, But I Complained Right Back And Told Her, "Well I Can Hear You Masturbating All The Time Too!" And When This Horny

  • emi fukada aika censoredcreampieblowjobMEYDtameike gororyo inugamiMEYD-662MEYD662meyd00662
    • 2021-03-17
    46 min

    [031721-001][VR] Meet a Soapland Angel

  • airi mikumo uncensoredcreampiecaribbeancom
    • 2021-03-19
    45 min

    [ETQR-211](Daydream POV Fantasies) Deep And Rich Sex With A Gorgeous Office Lady Yui

  • censoredcreampieuniformETQRerotic timeETQR-211ETQR211h-1186etqr00211
    • 2021-03-25
    57 min

    SIRO-4464 [First shot] [Beautiful nude with huge breasts and Momojiri] [Superb suction service] A busty clerk working at an apparel store in Shin-ku, Tokyo. She is obedient and shows off even ornamental masturbation .. AV application on the net → AV

  • amateur censoredbig titsamateursirosiro-4464siro4464siro-4464
    • 2021-03-25
    483 min

    [FCDSS-008]This Adorable Nursery School Teacher's Hobby Is Cosplay! Sakura Tsukino's First BEST Collection 8 Hours

  • tsukino sakura censoredbeautiful girlFCDSSfalenofaleno starFCDSS-008FCDSS0081fcdss00008
    • 2021-03-26
    51 min

    499NDH-010 Eat In The College Student Courier Who Came For Delivery! Mode ON that was spoiled by tipsy! Push down the staff and blame the nipples Spider Cowgirl! ？？ In return, it’s a mess on the ekiben of Geki Pis! [Delivery-chan. 3rd case]

  • nagisa censoredamateurndhndh-010ndh010499ndh-010
    • 2021-03-26
    129 min

    [KUM-018]Mitsuki Nagisa Revealed

  • scooping censoredcreampiebig titsKUMprestigejanhirokyuryu prestigeKUM-018KUM018118kum00018
    • 2021-03-26
    39 min

    480FRIN-025 《Personal shooting》 Entertainment talent Idol 1 ● years old Entertainment class Pillow SEX outflow with serial drama producer

  • amateur censoredcreampieamateurfrinfrin-025frin025480frin-025
    • 2021-03-30
    134 min

    [KMHRS-041]Her Unblemished Body Marked By 11 Loads Of Cum, Plus The First Creampie G*******g Of Her Life Misuzu Miyamori

  • misuzu miyamori censoredcreampieamateurKMHRSsod createkirinkimihoreKMHRS-041KMHRS0411kmhrs00041
    • 2021-04-01
    61 min

    324SRTD-0223 OL with beautiful skin who works too hard and does not know play

  • amateur censoredamateursrtdsrtd-0223srtd0223324srtd-0223
    • 2021-04-08
    122 min

    [FSDSS-203]Cumming For The First Time! 4 Orgasms Super Beautiful Girl All Sex Special Momo Honda

  • honda peach censoredsquirtingblowjobFSDSSfalenomusetafaleno starFSDSS-203FSDSS2031fsdss00203
    • 2021-04-22
    21 min

    HEYZO 2503 Anna’s Amazing Hand Job – Anna Honda

  • anna honda uncensoredblowjobhandjobheyzo
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-13
    150 min

    [DOCP-295]ブラコンが過ぎる巨乳妹とその巨乳の友達に挟まれおっぱいハーレム3P！！

  • amateur censoredcreampiebig titsdocpdocp-295docp295docp-295
    • 2021-05-21
    162 min

    [HND-991]Open Season Gorgeous I-Cup College Girl Gets Cum Inside For The First Time Momo Maeda

  • maeda momoko censoredcreampiebig titsHNDhon nakamametaro mamezawaHND-991HND991hnd00991
    • 2021-05-21
    135 min

    [JUL-590]I Was Caught By My Horny Father-In-Law Who Returned From A Three Month Fishing Trip With Pent Up Lust He Was Ready To Release Nanase Asahina

  • asahina nanase censoredmature womansingle workJULmadonnaunicorn fukudaJUL-590JUL590jul00590
    • 2021-07-02
    160 min

    [JUL-644]Yuko Shiraki Adult Style Skills Honed By Years Of Experience Documentary Drama Featuring Actress Yuko Shiraki

  • shiraki yuko censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-644JUL644jul00644
    • 2021-07-08
    115 min

    [GS-395]Office Girls Gone Bat Shit Wild And Fucking!! Stuck At The Office Late At Night With No Place To Go... I Wasn't Sure If She Was Into Me, But Then Something Got Into Her! At First There Was something About How She Was Looking At Me, But Th

  • censoredGSsosoru garcontanburaGS-395GS395h-101gs00395
    • 2021-07-08
    71 min

    515BTGL-010 ERIKA 2 (19)

  • amateur censoredcreampieuniformbtglbtgl-010btgl010515btgl-010
    • 2021-07-09
    163 min

    [DASD-891]Sexy-Bodied Girl Always Smiling and Overflowing with Charm Makes Her AV Debut Yuri Omori

  • yuri omori censoredbig titsblowjobDASDdasinnabarDASD-891DASD891dasd00891
    • 2021-07-13
    140 min

    [STARS-416]Flexible Ballerina Fucked With Huge Dick - 3 films. Anna [High-quality 4K images!]

  • anna censoredbeautiful girlsingle workSTARSsod createsuisei akaisod starSTARS-416STARS4161stars00416
    • 2021-08-06
    55 min

    480FRIN-044 << Personal Shooting >> Beautiful Charisma Model Affair Video Leaked Former J ● Exclusive Big Tits Model Cum Inside In A Secret Meeting With A Big Day Big P

  • amateur censoredcreampiebig titsfrinfrin-044frin044480frin-044
    • 2021-08-13
    121 min

    [PPPD-955]Spence Breast Development Clinic Kasumi Tsukino

  • kasumi tsukino censoredcreampiebig titsPPPDoppaiPPPD-955PPPD955pppd00955
    • 2021-08-20
    73 min

    [KAZK-065]I Called A Masseuse For My Step Grandma On Her Birthday For A Sensual Massage... Fumie Ogi (61)

  • fumie ogi censoredmomsingle workKAZKstar paradisekazoku star paradiseKAZK-065KAZK065h-254kazk00065
    • 2021-08-31
    49 min

    C0930 ki210831 Mari Tadokoro 50years old

  • amateur uncensoredc0930
    • 2021-09-10
    173 min

    [DASD-915]The Bitch"s Vulgar Fucking With Overly Gross Licking And Sucking. Akari Mitani

  • mitani akari censoredcreampieblowjobDASDdasnao masakiDASD-915DASD915dasd00915
    • 2021-09-12
    30 min

    FC2PPV 2190571 [Sequel] Very Popular! 18-Year-Old Active Girl ◯ Student Super Slender Beautiful Girl Rika-Chan Latest Work! Make A Swimsuit After School And Shoot A Large Amount Of Facial Cumshots For The First Time In Your Life!

  • amateur uncensoredfc2
    • 2021-09-24
    15 min

    FC2PPV 2243734 Prefectural Ordinary Course ③ After School With A Super Sensitive Beautiful Girl With Beautiful Legs In A Thousand Years …

  • amateur uncensoredfc2
    • 2021-09-30
    93 min

    355OPCYN-187 Amu (Amu Ohara)

  • amateur censoredbig titssquirtingopcynopcyn-187opcyn187355opcyn-187
    • 2021-10-02
    124 min

    [MOPT-011]The Masochistic Male Is A Living Creature That Is Tied Up. Getting Tied Up By A Slut, The Masochism Switches On. Miho Tomii

  • miho tomii censoredanalslutMOPTm o paradisemo tightMOPT-011MOPT011mopt00011
    • 2021-10-14
    125 min

    [AARM-025]All New Dirty-Talking Dildo Masturbation. Her Pussy Is Dripping Wet! 3

  • arimura nozomi chiharu miyazawa censoredAARMaroma kikakusatoshimaniaaromaAARM-025AARM025aarm00025
    • 2021-10-28
    58 min

    FCP-049 [Distribution Only] Stared By A Naughty Older Sister, Whispered And Fired … Super Goddess Handjob ＃ 1

  • amateur censoredamateurhandjobfcpfcp-049fcp049fcp-049
    • 2021-10-29
    95 min

    [ADN-354]Female Teacher Turned Into A Fuck Toy, Mako Iga

  • iga mako censoredsingle workdramaADNattackerssada oka sadaootona no dramaADN-354ADN354adn00354
    • 2021-11-11
    60 min

    C0930 ki211111 Hikaru Ukita 19years old

  • amateur uncensoredc0930
    • 2021-12-03
    69 min

    444KING-057 Karina (Yuria Hafuu)

  • amateur censoredcreampiesquirtingkingking-057king057444king-057
    • 2021-12-03
    146 min

    [CAWD-316]Erotic But Wise College Girl Gets Sexual Awakening And Has Wild Climactic Sex. Reina Mori

  • rena mori censoredbig titssquirtingCAWDkawaiirakudaCAWD-316CAWD316cawd00316
    • 2021-12-16
    67 min

    FC2PPV 2519228 [No Deletion Project] A Milk Deca H Cup With Such A Cute Face. Unauthorized Vaginal Cum Shot In A Teenage Nude With Overwhelming Beauty Big Tits Hidden In Uniform!

  • amateur uncensoredfc2
    • 2021-12-19
    58 min

    [HEYZO-2680]Keiko Udaka Defiling A Masochist Pervert Girl"s Body!

  • keiko udaka uncensoredcreampieblowjobheyzo
    • 2021-12-28
    63 min

    H4610 tk0050 Yuriya Kawasumi 22years old

  • amateur uncensoredh4610
    • 2022-01-15
    211 min

    [SORA-359]A Trip With My Fuck-Buddy. Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiedeepthroatSORAyama to soratelephone poleSORA-359SORA359sora00359



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download