drama javcensored married woman creampie censored




FC2ONEZPPPDKBIWAAAMILKMIAAHMNSQTEVEMAMARADASDNACRAVSAADNROYDNGODAPODBBANRBDSSNI

2020-10-16
483 min

[PPT-100]Non Nonoura 8 Hours BEST PRESTIGE PREMIUM TREASURE Vol.02 All 6 Videos + Previously Unreleased Videos To Track The Career Path Of Non Nonoura, In This Collector's Edition!!

  • nonoura warm censoredcosplaysingle workPPTprestigeno directorprestige premium treasurePPT-100PPT100118ppt00100
    • 2020-10-22
    121 min

    [FSDSS-113]Super Luxurious Men's Massage Parlor FALENO: Now On Special! Ayaka Tomoda

  • ayaka tomoda censoredhandjobsingle workFSDSSfalenomusetafaleno starFSDSS-113FSDSS1131fsdss00113
    • 2020-10-27
    244 min

    [MCSO-004]S-class Beauty Best: Nanako Miyamura 4 Hours, Beautiful Ass And Tits Madonna

  • nanako miyamura censoredMCSOmercurypremier dreamMCSO-004MCSO004h-1133mcso00004
    • 2020-11-18
    59 min

    475SKCK-011 Saki 2

  • amateur censoredanalamateurskckskck-011skck011475skck-011
    • 2020-11-19
    21 min

    Caribbeancom 111920-001 Pussy Encyclopedia: Rin Miura

  • rin miura uncensoredcaribbeancom
    • 2020-11-19
    149 min

    [SSNI-917]Amateur All Alone With Tsukasa Aoi !! Closeup One-on-One Service In This AV 10th Anniversary Super Fan Appreciation Special

  • tsukasa aoi censoredamateurblowjobSSNIs1 no 1 styletrendy yamaguchiSSNI-917SSNI917ssni00917
    • 2020-11-19
    120 min

    [TPPN-179]Her Sensitive Body Cums Hard - Wails Of Pleasure As Ecstasy Runs Through Her Whole Body Rika Aimi

  • rumi tadami censoredbig titsbeautiful girlTPPNteppanTPPN-179TPPN179tppn00179
    • 2020-11-25
    193 min

    [ENKV-001](Advance Distribution) Your Best Sex Matchups! 21-Year-Old Miyu, 20-Year-Old Akane, 28-Year-Old Rin

  • censoredcreampiebig titsENKVion mousouzokuENKV-001ENKV001enkv00001
    • 2020-12-03
    60 min

    Pacopacomama 120320_393 Ryoko Asamiya

  • ryoko asamiya uncensoredcreampieblowjobpacopacomama
    • 2020-12-11
    44 min

    FC2PPV 1602802 [Personal shooting] Infiltrate a secret orgy ㉒ Chubby lewd child ♥ Inject Ossan sperm one after another with a vaginal cum shot ♪ * High quality version & review benefits included ♪

  • amateur uncensoredfc2
    • 2020-12-17
    63 min

    200GANA-2402 In the spear room of the Nampa teacher of 100 battles, bring in SEX hidden shooting 184 Bring a beautiful girl with a fair body to the spear room! Two people who estrus with massage are inevitable sex ww Pull pull The amateur throat erot

  • amateur censoredamateurganagana-2402gana2402200gana-2402
    • 2020-12-27
    53 min

    H4610 ki210101 Miku Yamase 21years old

  • amateur uncensoredh4610
    • 2020-12-29

    FC2PPV 1624352 [Appearance / 3p] I lent money to my friend, but he didn’t return it, so I took my sister for interest.

  • amateur uncensoredfc2
    • 2020-12-31
    140 min

    [JUL-421]Married Esthetician Famous For Her Incredible Makeovers Hiyori Aso (Age 41) Makes Her Porn Debut!

  • hiyori aso censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-421JUL421jul00421
    • 2020-12-31
    116 min

    [JUL-435]Three Days Alone With The Aunt You've Always Wanted - This Lusty MILF Might Be Married, But You're All She Wants. Tsubaki Kato

  • kato camellia kaoru natsuki censoredmature womansingle workJULmadonnajo asagiriJUL-435JUL435jul00435
    • 2021-01-06
    120 min

    [GVH-177]Family Affair Yurika Aoi

  • yurika censoredcreampiemomGVHglory questkabin kizakuraGVH-177GVH17713gvh00177
    • 2021-01-09
    54 min

    HEYZO 2449 My Sister’s Fiance -Please Forgive Me For My Betrayal- – Nana Kamiyama

  • nana kamiyama uncensoredcreampieheyzo
    • 2021-01-11
    71 min

    328HMDN-327 Geki Kawa Class President A (18) The examinee came to have sex by skipping school w Pitch Pichi’s Roriman sucked a thick cock and squeezed climax! Chestnut died with rotor x demon piston! Naka is gone! Ahegao convulsions acme ♪

  • amateur censoredamateurbeautiful girlhmdnhmdn-327hmdn327328hmdn-327
    • 2021-01-15
    218 min

    [BAZX-267]POV Sex With A Beautiful Girl In Sailor Uniform vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-267BAZX267h-1496bazx00267
    • 2021-01-21
    207 min

    [SW-754]I Became a Teacher In Order To Have Sex With Cute Female S*****ts! 13

  • censoredbig titsSWswitchswitch switchSW-754SW7541sw00754
    • 2021-01-27
    79 min

    259LUXU-1373 Luxury TV 1358 [Natural busty sister is coming again! ] I want to see the overwhelming big tits that sway and dance with each piston forever! I’m thrilled by the gestures that sway the man’s heart …! Because of the greedy

  • amateur censoredbig titsamateurluxuluxu-1373luxu1373259luxu-1373
    • 2021-01-29
    51 min

    490FAN-092 Aoi 2

  • amateur censoredbig titsamateurfanfan-092fan092490fan-092
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-16
    140 min

    [STARS-327]This Tiny, 148cm-Tall Beautiful Girl Is Going Cum Crazy For Big Dicks! Orgasms To The Limit No Matter How Many Times She Cums, The Big Dick Super Furious Piston-Pounding Thrusts Will Never Stop Yuzu Shirakawa

  • yuzu shirakawa censoredbeautiful girldeepthroatSTARSsod createkaorusod starSTARS-327STARS3271stars00327
    • 2021-02-18
    120 min

    [SSNI-990]Busty Undercover Investigator Corrupted By A Lab-Grown Aphrodisiac Aika Yumeno

  • yumeno aika censoredbig titssingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-990SSNI990ssni00990
    • 2021-03-05
    66 min

    [SZKK-023]That Our Stepdaughter Would... - R-18/Minori Kurada

  • suzumiya kotone censoredsoloworkSZKKorustak softmasturbation supportSZKK-023SZKK023
    • 2021-03-07
    80 min

    200GANA-2450 Seriously Nampa, first shot. 1607 Successful pick-up of a beautiful woman with outstanding style! When she touches her frustrated body, she blushes and has an expression that she expected somewhere … Oma ○ Ko, who got wet with bisho

  • amateur censoredsquirtingamateurganagana-2450gana2450200gana-2450
    • 2021-03-18
    119 min

    [TPPN-187]Big Titty Amateur Big Plump Tits On Display Groping Squeezing And Sucking Festival

  • censoredbig titsamateurTPPNteppanTPPN-187TPPN187tppn00187
    • 2021-03-27
    150 min

    [BDSR-444]My Step Sister Was My First Love... Bittersweet Pure Love Life Mizuki Yayoi

  • mizuki yayoi censoredcreampiebig titsBDSRbig morkalyumejiBDSR-444BDSR44457bdsr00444
    • 2021-04-01
    119 min

    [DROP-060]Amateur Girls Give Their First Blowjob And Get Loads Blown In Their Mouths Without Warning 2

  • censoredamateurblowjobDROPoffice k sdrop office k sDROP-060DROP06036drop00060
    • 2021-05-01
    64 min

    200GANA-2480 Seriously Nampa, first shot. 1629 Picking up Shinjuku with a prize-winning Omikuji! Bring it to the hotel and have it draw an erotic lottery and rush into SEX! Because of the too sensitive omako, the whole body is jerky!

  • amateur censoredsquirtingamateurganagana-2480gana2480200gana-2480
    • 2021-05-21
    130 min

    [HZGD-189]"The Truth Is, Your Step Father Fucks Me Every Week On Tuesday" An Sasakura

  • an sasakura censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-189HZGD189h-1100hzgd00189
    • 2021-05-22
    241 min

    [SGSR-278]A State Of Emergency A Married Woman Nurse Has No Time To Even Sleep During This Breakdown Of The Medical Care System But I Still Want To Be Free To Fuck! Erotic, Deep And RIch, Full Contact Nursing, Late At Night To Satisfy Those Sexual Ur

  • censoredmature womannurseSGSRbig morkaleigyochuushinsengumiSGSR-278SGSR27857sgsr00278
    • 2021-06-11
    152 min

    [MIFD-163]This Fresh Face, F-cup Quarter Foreign Girl With Beautiful Skin's Sexual Desire Is Just Too Strong, She Refused To Wear The Condom And Got Her AV Debut With Creampie Sex!! Anna

  • censoredcreampiebig titsMIFDmoodyzusa pyonmoodyz freshMIFD-163MIFD163mifd00163
    • 2021-06-12
    122 min

    [SCOP-725]This Gal Was Wearing A Hoodie At Home But Not Wearing A Bra Or Panties And Totally Had Her Guard Down!! Even Though They Were StepB****************r, He Couldn't Control His Lust And In the End They Had Fakecest: Creampies Sex!! 2

  • censoredcreampiesisterSCOPscoopk taromousouzokuSCOP-725SCOP725scop00725
    • 2021-06-25
    83 min

    383REIW-076 Mina

  • amateur censoredbig titsamateurreiwreiw-076reiw076383reiw-076
    • 2021-07-18
    131 min

    [GMEM-038]ULTRA SWEET Loud Slut Wants To Be Fucked In Every Hole! Nene Tanaka

  • nene tanaka censoredsingle workGMEMavs collector sbaba za babbyavscollector s goldGMEM-038GMEM038gmem00038
    • 2021-07-31
    74 min

    FC2PPV 1948375 [○ Pond Meat Forest] Virgin-Kun, A Big Orgy In The Wilderness! A 〇 Can 〇, Open-Air Bath, Double Blowjob, Big Tits Fucking Anything

  • amateur uncensoredfc2
    • 2021-08-04
    120 min

    [GVH-273]ママのリアル性教育 波多野結衣 （GVH-273）

  • yui hatano censoredcreampiemomGVHglory questkisakura kabinGVH-273GVH27313gvh00273
    • 2021-08-07
    101 min

    [OIGS-040]A Married Woman Who Is Hooked On Bondage A Shaved Pussy Married Woman Office Lady Who Is Hopelessly Hooked On S&M Sex With Her Boss Rina Takase

  • rina takase censoredbdsmsingle workOIGSavsusubashi suiavscollectorsOIGS-040OIGS040oigs00040
    • 2021-09-09
    132 min

    [SPRD-1456]Asking My Father-in-law To Make Me Pregnant Without Telling My Husband Hana Haruna

  • haruna hana censoredmature womansingle workSPRDtakara eizouhotate ikkanaleddinSPRD-1456SPRD145618sprd01456
    • 2021-09-09
    125 min

    [NEO-763]Gal Saliva Bullying Runa Shimotsuki

  • shimotsuki runa censoreddeepthroatsingle workNEOradixsakuraba kyuu kokoro otokoneo radixNEO-763NEO763433neo00763
    • 2021-09-10
    119 min

    [IPX-718]I Have A Request, Please Fuck My Brains Out ... Reverse Sugar Daddy Hunting Orgasmic Sex We Gathered The Best Amateur Sex Addicts From Around The Country, Girls Who Use Social Media To Find The Greatest Orgasmic Experiences Miu Shiromine

  • shiramine miu censoredblowjobsingle workIPXidea pocketzaku araidishIPX-718IPX718ipx00718
    • 2021-09-23
    127 min

    [SPRD-1461]I Want To Make My Stepmom Pregnant - Yumiko Sakura

  • yumiko sakura censoredmature womansingle workSPRDtakara eizouhotate ikkanaleddinSPRD-1461SPRD146118sprd01461
    • 2021-09-25
    138 min

    [JUKF-070]A S********l Hunts For A Sugar Daddy Sara-chan (Residence: Koto Ward) Sara Kagami

  • kagami sara censoredcreampieschoolgirlJUKFjumpjump avJUKF-070JUKF070h-227jukf00070
    • 2021-10-16
    120 min

    [GS-2027]True Stories - Step-Siblings [48] After that

  • sakashita maki censoredGSgo go zutakahashi kouichigosGS-2027GS2027
    • 2021-10-22
    176 min

    [MISM-218]Her Deep Throat Is Hungry Her Long-Awaited Oral Subjugation This Shy Girl Is Showing Off Her Maso Style With A Smile I"m Going To Do My Best To Do A Deep Throat Blowjob! Yukina-chan

  • censoredbeautiful girldeepthroatMISMemumusume labMISM-218MISM218mism00218
    • 2021-10-23
    148 min

    [CEMD-070]男をいじめると感じる女子は実在する！3 辻井ほのか ～残酷ないじめで感じまくる最恐変態女の性行為！

  • tsujii honoka censoredbig titsmature womanCEMDserebu no tomoCEMD-070CEMD070cemd00070



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download