dldss




FC2STARSABWJUFEJULFSDSSMARACESDKSBJWAAAAWDGVHSQTENACRAVSAGMEMDASDAPODAMBIDASDDTT

2020-09-05
121 min

[GS-1988]Sexual Massage Salon Voyeur 03

  • censoredmomGSgosGS-1988GS1988h-101gs01988
    • 2020-09-20
    48 min

    FC2PPV 1508565 [Personal shooting] * Translated by Ali, a student teacher! Even though she is a married woman, she drowns in another stick and falls into a negative spiral. The plump body trembles and writhes!

  • amateur uncensoredfc2
    • 2020-09-25
    299 min

    [WZEN-038]Official Site: Girl x Guy x Girl @gyaku_3p.com - Threesomes Have Got To Be 2 Girls, 1 Guy! 5-Hour BEST Collection - 20 Amateur Girls

  • censoredblowjobhandjobWZENwaap entertainmentWZEN-038WZEN0382wzen00038
    • 2020-10-03
    44 min

    FC2PPV 1522091 [Personal shooting] Karin 22-year-old college student ★ Female college student looking for a job! It is a vaginal cum shot in a shaved pussy!

  • amateur uncensoredfc2
    • 2020-10-08
    126 min

    [FGAN-025]Creampie Lewd Girl Ami - Ami Kashiwagi

  • ami kashiwagi censoredcreampiesingle workFGANfetish eyesFGAN-025FGAN025h-1440fgan00025
    • 2020-10-11
    151 min

    [CHRV-117]"If You Take It Off, You'll Have A Titty Fuck, And If You Masturbate, A Huge Dildo! Suzy-Chan Loves Rubbing! Can't Stop Looking At My Step Sisters' Huge Tits ! H-Cup 96cm Chinatsu

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-117CHRV117chrv00117
    • 2020-10-15
    93 min

    [NUKA-042]Six Creampies Without Cumming - Hot And Heavy At-Home Fucking Mari Kuroki

  • kuroki mari censoredcreampiemature womanNUKAcenter villageminatoyazegu center villageNUKA-042NUKA042h-086nuka00042
    • 2020-10-16
    63 min

    [DHT-171]Akari Asagiri Will Break You In Nice And Gentle - Guys Lose Their Virginity On Camera

  • censoredbig titsmature womanDHThot entertainmentkazuki enDHT-171DHT17159dht00171
    • 2020-10-30
    36 min

    483HMHI-581 Emiri

  • amateur censoredbig titsamateurhmhihmhi-581hmhi581hmhi-581
    • 2020-10-31
    77 min

    200GANA-2377 Seriously Nampa, first shot. 1548 Beautiful lounge lady found in Azabu! !! Show off a number of amazing tech cultivated in the service to Uncle Patron! !! Shake the boobs of the H cup and repeat the gingin and hip swing cum! !!

  • amateur censoredbig titssquirtingganagana-2377gana2377200gana-2377
    • 2020-11-06
    43 min

    396BIG-090 Hane hana

  • amateur censoredcreampiesquirtingbigbig-090big090396big-090
    • 2020-11-20
    119 min

    [HZGD-171]NTR The Married Woman Next Door Fucked My Husband... She Used Her Tanned Body And G-Cup Titties To Lure Him To Commit Infidelity And Creampie Sex, Over And Over Again Kaho Imai

  • natsuho imai censoredcreampiebig titsHZGDmarried woman flower garden theaterzampaimage married woman flower garden theatHZGD-171HZGD171h-1100hzgd00171
    • 2020-12-01
    120 min

    [TUE-107]Filthy Video Record Of Fucking A Naughty Step-Niece

  • censoredcreampiebeautiful girlTUEglay zteitora eizoTUE-107TUE10712tue00107
    • 2020-12-02
    72 min

    FC2PPV 1592116 [Personal shooting / set sale] Wife who entrusts her child and eats another stick for her desires 1st & 2nd

  • amateur uncensoredfc2
    • 2020-12-06
    241 min

    [MMB-339]Momotaro Presents Natural Airhead Big Tits Best Hits Selection!!! 10

  • inaba kurata mao censoredbig titsMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-339MMB339mmb00339
    • 2020-12-15
    176 min

    [PTS-474]Smoking Hot Transsexual - Passionate Lesbian Sex Vol. 6 - High-Class Wife's Erotic Oil Massage Parlor

  • julia takigawa namiki touko censoredcreampiePTSpetersPTS-474PTS474h-021pts00474
    • 2021-01-14
    106 min

    [ZEAA-057]Absolute Obedience Face Fuck: Married Slut Who Loves To Have Her Throat Pounded Noa Kosaka

  • kosaka censoredcreampiemature womanZEAAcenter villageamagumogoku centervillageZEAA-057ZEAA057h-086zeaa00057
    • 2021-01-21
    130 min

    [IENF-123]College Girl In Love With Her Stepfather Lets Him Catch Glances Of Her Panties When Mom Isn't Looking! Hoping For A Creampie, She Lets Him Fuck Her Raw Over And Over Again!!

  • toua kotone asahi drop censoredbeautiful girlslutIENFienergyienfIENF-123IENF1231ienf00123
    • 2021-02-06
    146 min

    [JUL-465]I, The Greeter, Went On An Adulterous Drive With The Company President's Wife. Maki Hojo

  • hojo asahi censoredmature womansingle workJULmadonnahiroyuki kimuraJUL-465JUL465jul00465
    • 2021-02-25
    120 min

    [FSDSS-177]If You Get Caught, You're Out! We Pretended To Be A Couple And Entered This Establishment, Undercover! Dripping With Adrenaline The Ultimate Real And Silent Sex At A Business Establishment, While They're Still Open For Business Tin

  • nanami tina censoredsingle workFSDSSfalenoponyfaleno starFSDSS-177FSDSS1771fsdss00177
    • 2021-02-25
    130 min

    [RCTD-386]When My Dad Got Remarried, My New Stepsister Turned Out To Be My Classmate, Who I Hate So Much, I Fight With Her Every Day. We Didn't Want To Make Our Parents Worry, So We Started Keeping Our Voices Down To A Whisper When We Fought. A N

  • ai kawana tsugumi mizusawa censoredschoolgirllesbianRCTDrocketscarecrowRCTD-386RCTD3861rctd00386
    • 2021-02-25
    39 min

    [GRKG-006]友達の家で、友達の寝ている横で、友達の好きな人と…。欲望剥き出しでハメまくる禁断の寝取りセックス

  • mihina azumihina mihina nagai hiroomi nagase censoredGRKGkageki chleo hakusanGRKG-006GRKG006h-1535grkg00006
    • 2021-03-08
    52 min

    492MERC-242 The teacher has already quit …

  • amateur censoredbig titsuniformmercmerc-242merc242492merc-242
    • 2021-03-11
    118 min

    [HBAD-577]My Step Sister's Sex Drive Is So Uncontrollable That No One Is Safe Miu Narumi

  • narumi miu censoredHBADhibinorokutani masafumibabeHBAD-577HBAD5771hbad00577
    • 2021-03-13
    363 min

    [VEMA-160]I Ordered A Delivery Health Call Girl And To My Surprise, The Class Madonna From My S*****t Days Showed Up At My Door! At The Time I Was At The Bottom Of The School Hierarchy And She Never Even Took Notice Of Me Because I Was A Bullied Lose

  • censoredcreampiemature womanVEMAvenusmegami venusVEMA-160VEMA160vema00160
    • 2021-03-19
    222 min

    [ABW-067]An Mitsumi The Virginity Stealer 40 3 Virgin Amateurs Lose Their Virginity To Her Pussy! 100 Cum Rate

  • an mitsumi censoredbig titsblowjobABWprestigephnom penhabsolutely wonderfulABW-067ABW067118abw00067
    • 2021-04-09
    118 min

    [IPX-638]I Can't Stand My Horny Stepdad... But I'm His Favorite Dish... Ravished Again And Again And Made To Cum Ema Futaba

  • futaba emma censoredschoolgirlbeautiful girlIPXidea pocketdishIPX-638IPX638ipx00638
    • 2021-04-16
    33 min

    285ENDX-339 A very active English teacher. Get drunk and increase sensitivity!

  • amateur censoredcreampiebig titsendxendx-339endx339285endx-339
    • 2021-05-06
    83 min

    FC2PPV 1789804 [Stage actress] [Immediate deletion of body baldness] From a child actor, a tall slender black-haired beautiful girl, top secret data leaked before sale! Raw vaginal cum shot that pierces deep into the womb and trembles [High quality D

  • amateur uncensoredfc2
    • 2021-05-07
    175 min

    [NHDTB-525]Faithless Wife In Sexy Lingerie Seduced The Hung Neighbor Next Door And Now He Won't Stop Drilling Her No Matter How Many Times She Cums

  • censoredsquirtingslutNHDTBnatural highremonha to nakashimaNHDTB-525NHDTB5251nhdtb00525
    • 2021-05-22
    123 min

    [AVSA-167]Slutty Girl With A Sexy Tongue AIKA

  • aika censoredslutsingle workAVSAavs collector sbuddha davscollector sAVSA-167AVSA167avsa00167
    • 2021-05-22
    138 min

    [CEMD-011]5 Seconds Before Your Dick Breaks! SEX With A Full-course Slut That Doesn't Hold Back - Honoka Tsujii

  • tsujii honoka censoredbig titsblowjobCEMDceleb no tomoCEMD-011CEMD011cemd00011
    • 2021-05-22
    44 min

    FC2PPV 1831192 147cm E Cup ♥ Chibi Big Breasts Chika (19 years old JD) "It was warm ♥" I was fascinated by the first sperm bukkake in my life … Suddenly in the bath! In the washroom! !! [4th]

  • amateur uncensoredfc2
    • 2021-06-03
    116 min

    [AKDL-115]Becoming A Sexual Prey At My New Job, The Whole Department Together

  • karen asahina yura marino censoredbig titsdramaAKDLaquinoriaquinoriaknrAKDL-115AKDL1151akdl00115
    • 2021-07-01
    116 min

    [DROP-063]She's Dribbling Serious Cum Facial Drips Down Her Cheek And Cumming Like Crazy!! Amateur Girls Are Pumping Their Pussies In Finger Banging Masturbation Pleasure 3

  • censoredamateurDROPoffice k sdrop office ksDROP-063DROP06336drop00063
    • 2021-07-15
    157 min

    [MMKZ-099]Cute Face Big Ass!! Rei Kuruki

  • satoshi kuruki censoredbeautiful girlsingle workMMKZmarrionkojiro miyamotoirisMMKZ-099MMKZ099mmkz00099
    • 2021-07-30
    41 min

    481SACZ-059 Yuko 1

  • amateur censoredmarried womanamateursaczsacz-059sacz059481sacz-059
    • 2021-08-19
    55 min

    ORETD-887 NANAMI (Yokomiya Nanami)

  • amateur censoredcreampieuniformoretdoretd-887oretd887oretd-887
    • 2021-08-24
    81 min

    FC2PPV 2062211 [Personal Shooting] Single Mother Living In Shikoku Visiting A Real Home And Having A Live Sex & Handjob Bukkake

  • amateur uncensoredfc2
    • 2021-08-30
    102 min

    [ACZ-030]A Subservient Wife Who Swore Eternal Allegiance When She Entered Into An S&M Marriage (A Bride Who Descended Into The Pleasures Of Sex With Several Men) (The Domesticated Bitch Collector Vol.28)

  • censoredamateurbdsmACZsanwa publishingabnormal.companiesACZ-030ACZ030h-019acz00030
    • 2021-09-02
    71 min

    [REBD-586]Kiu - Bratty Girl Limit Break. Kiu Aihara

  • aihara tsukiha censoredsingle workREBDrebeccaherpes takaREBD-586REBD586h-346rebd00586
    • 2021-09-10
    155 min

    [BBAN-341]This Big Tits Private Tutor Received Breaking In Training From A Doting Mama - An Instructional Lesbian Series Of Love, Slathered In Slobbering Drool - Waka Misono Hazuki Wakamiya Hikaru Minazuki

  • misono waka wakamiya censoredbig titssquirtingBBANbibianBBAN-341BBAN341bban00341
    • 2021-09-10
    142 min

    [IPX-733]I"ve Got A Girlfriend Waiting For Me At Home, But When I Missed The Last Train, My Supervisor Said I Could Stay At Her Place... I Couldn"t Resist The Way She Looked Without A Bra Or Panties And We Wound Up Fucking All Night Long... H

  • hatsukawa minami censoredblowjobslutIPXidea pocketbungo maedadishIPX-733IPX733ipx00733
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-23
    45 min

    H0930 ki210923 Mika Tamura 32years old

  • amateur uncensoredh0930
    • 2021-09-25
    240 min

    [NANX-236]Picking Up Girls With Blonde Hair Who Want To Have SEX With Japanese Guys. Fucking Around On A Business Trip To Europe. A 4 Hour Special

  • censoredcreampiebig titsNANXk m producenanpa heavenNANX-236NANX236nanx00236
    • 2021-09-25
    240 min

    [ENKI-041]Saya Is The Strongest And Most Powerful Sex Monster Of The Reiwa Era She"s A Horny Bitch Who Is Addicted To Cock And Now She Needs A Brutal Treatment Of Pussy-Pounding Cock Injections! A Lusty Beast Gets A G*******g Preion Of Impregnati

  • censoredcreampieENKIpoisonous banquetENKI-041ENKI041enki00041
    • 2021-10-15
    240 min

    [DVDMS-729]Colossal Tits. Slut With Milky Jugs To Suck. Curvy College Girl With Super Sexy Tits For Ample Fun! Hot, Sweat-dripping Fucking For This Amazing Big Titty Slut.

  • ena koume himesaki hana censoredbig titsslutDVDMSdeepsmotofuji peroflavorsDVDMS-729DVDMS729dvdms00729



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download