digital mosaic hot spring housewife censored mature woman




FC2NATRCAWDNACRMIDVPPPDSSNIDASDSSISSQTEHDKAIPXLULUADNSTARSBLKHNDHUNTBWAAAAUKSDASD

2020-12-21
132 min

[OPPW-080]The Semen D***k Bar Who's Semen Tastes The Best？ Does It Taste Better When Mixed Together!？ My Very Own Special Recipe! Mona Kisaragi

  • mona kisaragi censoredsingle workOPPWopenipeni world mousouzokuumanosukeOPPW-080OPPW080oppw00080
    • 2020-12-24
    201 min

    [DANDY-742]"Is It Really OK For Me To Be Your First Fuck？" Honoka Tsujii Helps Break You In

  • tsujii honoka censoredbig titssingle workDANDYdandymongolian sanoDANDY-742DANDY7421dandy00742
    • 2020-12-25
    64 min

    [DHT-217]"You Don't Get Excited By Me, Do You？" An Obedient Wife With Super Small Tits Who Works Hard - Sakura, 28 Years Old

  • censoredmarried womanamateurDHThot entertainmentprotectDHT-217DHT21759dht00217
    • 2020-12-29
    87 min

    [MBRBA-069]朝倉沙月 キックボクサーでファッションモデルもこなす美女 デビュー

  • censoredMBRBAspice visualMBRBA-069MBRBA0695050mbrba00069
    • 2021-01-14
    147 min

    [SPRD-1363]My Fuck Buddy Back Then... Was My Friend's Mother Reiko Kobayakawa

  • kobayakawa reiko censoredmature womansingle workSPRDtakara eizokon oriharualeddinSPRD-1363SPRD136318sprd01363
    • 2021-01-18
    51 min

    IDJS-033 Reiko

  • amateur censoredamateurblowjobidjsidjs-033idjs033idjs-033
    • 2021-01-20
    98 min

    [KIR-025]My Wife Started Working As A Maid... And Now The Rich Guy She Works For Is Using Her As A Cum Dumpster Chiharu Miyazawa

  • chiharu miyazawa censoredcreampiesingle workKIRstar paradisekirei star paradiseKIR-025KIR025h-254kir00025
    • 2021-01-22
    70 min

    [orex-198]あいなさん

  • amateur censoredcreampieamateurorexorex-198orex198orex-198
    • 2021-01-24
    180 min

    [EYS-061]Hidden SEX Shooting With One Of My Mom's Friends Who Likes To Take Care Of Me vol. 2

  • censoredbig titsblowjobEYSstudio i sEYS-061EYS061eys00061
    • 2021-01-24
    128 min

    [CESD-969]Her First Lesbian Performance: Fresh Face Actress Rara Momota x Veteran Lesbian Rena Aoi - First Time Same-Sex Lusty Love Session

  • also brought blue censoredlesbianmature womanCESDceleb no tomoCESD-969CESD969cesd00969
    • 2021-02-18
    143 min

    [ROYD-042]Only I Know That The Prim, Proper-Looking Girl In Glasses At My Work Is Really A Secret Slut With Pale Skin And Colossal Tits Rina Takase

  • rina takase censoredcreampiebig titsROYDroyalcognac kaminohhh groupROYD-042ROYD042royd00042
    • 2021-02-19
    240 min

    [MBM-270]"I'll Swallow Your Whole Dick..." Mature Sluts Slurp Up Cocks With Their Tight, Wet, Hungry Pussies! Passionate MILF Cowgirl FUCKS 12 Girls, 4 Hours

  • censoredbig titsmature womanMBMprestigesasazuka garoumbmMBM-270MBM270118mbm00270
    • 2021-02-21
    116 min

    [CJOD-282]"I Told You I've Already Ejaculated!" The Soapland Of Agony Unlimited Creampie Ejaculations! Follow-Up Man-Squirting! An Orgasmic Full Course Of Erotic Semen-Squeezing Yukino Nagisa

  • yukino nagi censoredcreampiebig titsCJODchijo heavenhirokoji osakiCJOD-282CJOD282cjod00282
    • 2021-02-21
    72 min

    300NTK-523 Sober female character sudden change! !! H cup Echi Echi GAL! !! Cleavage pushing costumes and sexual desire demons …! !! With erotic breathing and sexual harassment posing guidance, the meat pillar is erected and all concentrated fin

  • amateur censoredcreampiebig titsntkntk-523ntk523300ntk-523
    • 2021-02-23
    133 min

    [STARS-329]Shared Room NTR After Filming This Elder Sister Type Weather Girl Was Unable To Get Back To Tokyo After Being Caught In A Snowstorm, So She Spent The Entire Night With The Fresh Face Assistant Director Who Always Listens To Her Bitch About

  • mahiro yui censoredcreampiesingle workSTARSsod createbungo maedasod starSTARS-329STARS3291stars00329
    • 2021-02-26
    43 min

    [CLO-129]A Stubborn And Relentless Massage Parlor Where, No Matter What Part Of Your Body Is Being Treated, They'll Always Make Sure To Drop By Your Nipples Meisa Chiba

  • chibana meisa censoredslutCLOchobitchchovicCLO-129CLO129h-1435clo00129
    • 2021-03-09
    54 min

    FC2PPV 1699799 [Personal shooting] Innocent shaved busty plump daughter Maho-chan with a large amount of raw vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-03-29
    46 min

    292MY-432 Anri Shinomiya 2

  • amateur censoredcreampiebig titsmymy-432my432292my-432
    • 2021-04-02
    220 min

    [DVDMS-652]Normal Man And Woman Monitoring Porn, Following Boss And Employee That Stay At Love Hotel, Coworkers Miss The Last Train And Creampie Fuck At Love Hotel!... The Sequel: Peeping Video Of Raw Fucking Secret From The Company That Didn't E

  • censoredcreampieamateurDVDMSdeep sostracismDVDMS-652DVDMS652dvdms00652
    • 2021-04-15
    65 min

    336KNB-150 I Can’t Be Satisfied With Sex With My Husband And Apply For AV! Contrary to the appearance that seems to be an adult, the sensitivity is good and the intense erotic reaction! !! A mysterious wife who trembles with a pleasant sensation

  • amateur censoredbig titsmarried womanknbknb-150knb150336knb-150
    • 2021-05-15
    251 min

    [SORA-313]Slutty S********l Exposes Herself I Was Appointed To Be The Record-Keeper Rion Izumi

  • rion izumi censoredslutsingle workSORAyama to soratelephone poleSORA-313SORA313sora00313
    • 2021-05-19
    49 min

    396 BIG-104 Risa

  • amateur censoredcreampieschoolgirlbigbig-104big104396big-104
    • 2021-05-20
    120 min

    [DLDSS-009]"Are You Sure You Want To Have Your First Time With Me？" Riho Agatsuma Sexily And Sweetly Takes Your Virginity 4 Rounds

  • riho gazuma censoredbig titssingle workDLDSSdahliaponyDLDSS-009DLDSS0091dldss00009
    • 2021-06-12
    135 min

    [BEFG-002]Interrogation Investigator ~ PERSONA ~ Episode 1 Sacrificial Flower Writhes In Agony As She's Caught Up In A Trap Of Torment Ruka Inaba

  • inaba censoredbdsmsingle workBEFGbabyentertainmentkikubongolden babeBEFG-002BEFG002befg00002
    • 2021-06-17
    240 min

    [VENX-050]"Do Older Lady Panties Excite You？" Step Aunt Drains Her Step Nephew Dry Of Every Last Drop Of Cum With Her Fresh Panties Highlights

  • censoredcreampiemarried womanVENXvenusincestVENX-050VENX050venx00050
    • 2021-06-20
    166 min

    [DGCEMD-022]Online Exclusive! With Special Bonus Footage - Wild Sub Porn Star Ayaka Mochizuki's First Anal Sex! Drilled In All Three Holes Until She Cums!

  • ayaka mochizuki censoredcreampiemature womanDGCEMDcelebrity friendsDGCEMD-022DGCEMD022dgcemd00022
    • 2021-06-20
    120 min

    [SRMC-033]Hypno-drama: A Wife With A Big Ass Drowning In Influenced Pleasure - Yurika Aoi

  • yurika censoredsquirtingsingle workSRMCh m rashmiyoshi rusherSRMC-033SRMC033srmc00033
    • 2021-06-26
    67 min

    [DANDAN-003]She Can Never Say No! Nurse With H-Cup Tits Devotedly Services Her Patients With Titty Fucking Miss Arioka

  • censoredbig titsblowjobDANDANdandytanaka baconDANDAN-003DANDAN0031dandan00003
    • 2021-07-15
    134 min

    [SOAN-062]The Anal PCR Test 300 Anal Cherry Boy Virgins Get Down To Business With An Anal Elder Sister Type Who Gets 2-Hole Fucked For The First Time In A Glory Hole Spasmic Orgasmic Anal Fuck Fest!! The S**ttering Of An Anal Rose A Currently Active

  • censoredamateurSOANyama to soramaketaro tanizokoanal visitSOAN-062SOAN062soan00062
    • 2021-07-30
    117 min

    [DFE-055]My Stepdaughter Supports Me. Nanami Yokomiya.

  • yokomiya nanami censoredcreampieuniformDFEwaap entertainmentsasanishikifearlessDFE-055DFE0552dfe00055
    • 2021-08-02
    31 min

    FC2PPV 1951099 First Shot! !! Limited Number! Creampie Twice To A Nasty Neat And Clean Beauty With Outstanding Sensitivity Who Cums With Bikunbikun! !! (Feature Film)

  • amateur uncensoredfc2
    • 2021-08-07
    260 min

    [MDTE-011]I Met Up With An Erotically Cute Currently Active College Girl On This Divine App, And We Enjoyed 4 Hours Of Creampies, In The Raw 05

  • censoredcreampiebeautiful girlMDTEspace planningtetMDTE-011MDTE011mdte00011
    • 2021-08-12
    145 min

    [SPRD-1447]After The Class Reunion... Hono Wakamiya

  • honoka wakamiya censoredmature womansingle workSPRDtakara eizoutakara hiroshialeddinSPRD-1447SPRD144718sprd01447
    • 2021-08-20
    149 min

    [JUL-682]Super Celebrity I-Cup Beautiful Witch Finally Tries A (Creampie). Secret Meeting On The Most Dangerous Day Creampie Every Month, My Husband"s Best Friend Comes To Make Babies... Uno Kanaya

  • kanaya uno censoredcreampiebig titsJULmadonnahimurokkuJUL-682JUL682jul00682
    • 2021-08-20
    152 min

    [CAWD-261]"Hey, Who Do You Like？" 31 Days Of Immersive And Intense Creampie Fucking With Two Younger Step-Sisters Fighting Over Me... Yui Amane Mitsuki Nagisa

  • amane yui scooping censoredcreampiesquirtingCAWDkawaiiakai suiseiCAWD-261CAWD261cawd00261
    • 2021-08-26
    125 min

    [HBAD-593]I Am Weak-willed, I Can"t Refuse... A Compliant Wife With Colossal J-cup Tits And A Soft Body - Hana Himesaki

  • himesaki hana censoredbig titssingle workHBADhibinorokutanzono seishibabeHBAD-593HBAD5931hbad00593
    • 2021-08-31
    62 min

    FC2PPV 2113329 4 Days Limited Special Price !! [Peculiar Strong Woman ＃ 012] Iku Beauty Ol 28 Years Old With A Generalized Erogenous Zone Trained Woman Endless Nipple Groping Mad Fainting Acme Broken Kimepako ♡

  • amateur uncensoredfc2
    • 2021-09-08
    58 min

    SIRO-4621 [First Shot] [Dada Leaked Eros] [Enchanted F Milk] A Flower Coordinator With A Strong Libido Who Exudes Erotic From The Looks Has Appeared. A Superb Body That Has Been Captivated By Many Males Straddles A Big Cock And Makes A Tremendous Eff

  • amateur censoredbig titsamateursirosiro-4621siro4621siro-4621
    • 2021-09-09
    42 min

    FC2PPV 2181553 Limited Number! Appearance! Moved To Tokyo Aiming For "# 2" Trimmer. Creampie While Letting An Innocent 18-Year-Old Girl Say "I Like It. I Love It". Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-09-16
    62 min

    FC2PPV 2208271 [Complete Amateur 118] JD Ako 20 Years Old, That Beautiful Girl Who Is Almost A Virgin Challenges The Second Sex With The Ban On Appearance! Premium 4K

  • amateur uncensoredfc2
    • 2021-09-24
    125 min

    [ROE-009]- Young Wife Babes Who Gave Up And Let Themselves Be Fucked - This Young Wife Stopped Resisting As She Got Fucked In Her Own House One Afternoon, And Allowed Herself To Be Toyed With In An Endless Cycle Of Deep Throat Dick Sucking And Creamp

  • nozomi sakai censoredmature womansingle workROEmadonnabiba gonzomonroeROE-009ROE009roe00009
    • 2021-10-09
    134 min

    [MKMP-419]Inviting My Mistress Over For Non-stop French Kissing Cowgirl Fucking That Practically Melts My Lips And Dick. Honoka Tsujii

  • tsujii honoka censoredblowjobslutMKMPk m producekindaichishougo roumillionMKMP-419MKMP419mkmp00419
    • 2021-10-15
    123 min

    [FOCS-029]Picking Up Girls To Meet An SSR Tier Ultra Cute Gal That Wants To Be A Total Fuck Buddy! Face Off To See Who Gets To Fuck! Record Of This Slutty Girl"s Amazingly Hot Sex! Yuna Himekawa

  • yuuna himekawa ran tsukishiro censoredslutsingle workFOCSabc mousou zokufocusFOCS-029FOCS029focs00029
    • 2021-10-16
    61 min

    Pacopacomama 101621_546 Punishing A Mature Woman Who Feels Excessive Misato Wakaba

  • amateur uncensoredpacopacomama
    • 2021-10-25
    61 min

    SIRO-4675 [First Shot] [Beautiful Leg Slender] [Ascension With Slamming Back] Excavated An Active JD Who Has Been Away From Sex For A Long Time And Has Sexual Desire. When An Imadoki Girl With A Serious Personality Immediately Screams With A Relentle

  • amateur censoredamateursirosiro-4675siro4675siro-4675
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-05
    121 min

    [HODV-21622]Perverted Tattooed Beauty Who Likes Face Fucking -Reira Kuon

  • leira haduki censoredcreampiedeepthroatHODVh m pHODV-21622HODV216225642hodv21622
    • 2021-11-06
    122 min

    [CEMD-077]AV Document On D***king All Day With Rin Kira!

  • kira rin censoredcreampiemature womanCEMDserebu no tomoCEMD-077CEMD077cemd00077



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download