devil censored beautiful girl jav javcensored




FC2JUFEHODVAPODMEYDHNDSANSPRDMILKCESDMVSDSSISVEMAEBODSDABONEZAUKGCAWDNACXDASDWANZ

2019-09-10
123 min

[STARS-117]Don't Let Anyone Know! Small Devil Uniform Girl Yuna Ogura Secretly Seduces In School

  • yuna ogura censoredbeautiful girlsingle workSTARSsod createkyoseisod starSTARS-117STARS1171stars00117
    • 2019-09-08
    151 min

    [IPX-368]A Budding Total Domain Alluring Temptation A Little Devil Beautiful Young Girl In Uniform And Knee-High Socks Kana Momonogi

  • kana momonogi censoredschoolgirlbeautiful girlIPXidea pocketkirindishIPX-368IPX368ipx00368
    • 2019-09-01
    119 min

    [TUE-092]Sex Videos With A Rough Sex-Loving Uncle Who Doesn't Care How He Gets His Filthy Way With This Young Girl

  • censoredcreampiebeautiful girlTUEglay zteitora eizoTUE-092TUE09212tue00092
    • 2019-09-01
    121 min

    [SCR-224]Absolute Recommendations From Genuine Lo**** Freaks 4 Cute Girls That Served Us Well

  • censoredcreampiebeautiful girlSCRglay zs crimeSCR-224SCR22412scr00224
    • 2019-09-01
    119 min

    [LOL-185]A Lo**** Specialty A Country-Bred Genuine Shaved Pussy Beautiful Girl On Summer Vacation Uru-chan

  • censoredcreampiebeautiful girlLOLglay zloli senkaLOL-185LOL18512lol00185
    • 2019-08-24
    146 min

    [DASD-569]National Horny Devil Championships No.1 - A Uniformed Young Girl Who Tempts You With Her Cowgirl Style - Momo Kato

  • kato momoka censoredblowjobbeautiful girlDASDdasnao masakiDASD-569DASD569dasd00569
    • 2019-08-09
    120 min

    [REAL-703]I'm About To Go And Fuck Everyone In This Family Ochiai, Shin**** Ward

  • ichijo mio misaka ria censoredbeautiful girlREALreal workssuisei akaireal real worksREAL-703REAL703172real00703
    • 2019-07-01
    121 min

    [SCR-222]Obscene Post Video By Devil Relatives-in-law - Daughter, Nephew, Sister

  • censoredcreampiebeautiful girlSCRglay zs crimeSCR-222SCR22212scr00222
    • 2019-02-01
    475 min

    [AVOP-469]30 Beloved Daughters Are Paid A Creampie Night Visit Because Papa's A Pervert! A Horny Video Record 8 Hours

  • censoredcreampiebeautiful girlAVOPtmaav open 2018AVOP-469AVOP46955avop00469
    • 2019-02-01
    177 min

    [AVOP-453]I'm About To Rape This Entire Family Denen***fu, in O**** Ward

  • mari takasugi rui hizuki censoredbeautiful girlAVOPreal worksnaveav open 2018AVOP-453AVOP453172avop00453
    • 2019-01-27
    153 min

    [MMUS-030]Beautiful Girl Little Devil Temptation Momo Kato

  • kato momoka censoredschoolgirlsingle workMMUSmarrionkijin kasaikcpMMUS-030MMUS030mmus00030
    • 2018-12-25
    119 min

    [KTRA-086]A Little Devil Little Sister With A Big Brother Complex Alone Together With Yui! The World's Most Sexiest Housesitting Yui Tomita

  • yu tomita censoredcreampiebeautiful girlKTRAk tribeKTRA-086KTRA086h-094ktra00086
    • 2018-12-23
    143 min

    [MMUS-029]A Little Devil Tempting Beautiful Girl Mai Yahiro

  • mai yahiro censoredschoolgirlbeautiful girlMMUSmarrionkijin kasaikcpMMUS-029MMUS029mmus00029
    • 2018-12-20
    136 min

    [NEO-666]Group Spit Teasing Spittoon Teen Maina Yuri

  • yuuri censoredbeautiful girlsingle workNEOradixshio sakurabaneo radixNEO-666NEO666433neo00666
    • 2018-12-14
    109 min

    300MIUM-371 Tipsy little devil Domaso beauty! !! !! Rich junkie hot beauty who gets drunk with friends at the end of work! Even if it’s a little bit rich, if you hit it richly, it will attack you by showing a cleavage glance! !! !! Such a sengeb

  • amateur censoredbig titsamateurmiummium-371mium371300mium-371
    • 2018-12-01
    163 min

    [MMUS-028]A Little Devil Tempting Beautiful Girl Tsubasa Hachino

  • yano tsubasa censoredschoolgirlbeautiful girlMMUSmarrionkijin kasaikcpMMUS-028MMUS028mmus00028
    • 2018-10-28
    137 min

    [MMUS-027]A Tempting Little Devil Beautiful Girl

  • mitsuki kamiya censoredschoolgirlbeautiful girlMMUSmarrionkijin kasaikcpMMUS-027MMUS027mmus00027
    • 2018-09-29
    479 min

    [BMW-166]A Little Devil Beautiful Girl Who Loves Sex Minori Kawana 8 Hours Best Hits Collection

  • real village hena censoredcreampiebeautiful girlBMWones factorywanzBMW-166BMW166bmw00166
    • 2018-08-26
    146 min

    [MMUS-024]Little Devil Tempting Beautiful Girl Yuna Ishikawa

  • yuna ishikawa censoredbeautiful girlMMUSmarriontakato kasaimcpMMUS-024MMUS024mmus00024
    • 2018-08-16
    129 min

    [IPX-192]Little Devil Beautiful Young Girl In Uniform Fucks Like A Slut When She Can't Make A Sound Or Face

  • kana momonogi censoredschoolgirlbeautiful girlIPXidea pockettiger gaveltissueIPX-192IPX192ipx00192
    • 2018-07-07
    183 min

    [MIDE-566]A Little Devil Female Manager Who Likes To Tease And Attack Shows Off Her Ejaculation Management Training Technique Chinami Ito

  • chinami ito censoredbeautiful girlMIDEmoodyzMIDE-566MIDE566
    • 2018-06-24
    135 min

    [MMUS-022]A Tempting Little Devil Beautiful Girl Mari Takasugi

  • mari takasugi censoredschoolgirlbeautiful girlMMUSmarriontakato kasaimcpMMUS-022MMUS022mmus00022
    • 2018-06-02
    170 min

    [BF-545]A Little Devil In Knee High Socks A Beautiful Young Girl In Uniform Kaho Aizawa

  • natsuho aizawa censoredsquirtingslutBFbefreebatten kyushu manBF-545BF545bf00545
    • 2018-06-01
    124 min

    [ONEZ-143]A Little Devil Schoolgirl Who Is Waiting For A Miracle FILE.001 Erica's Situation

  • censoredcreampieblowjobONEZprestigetodoonezONEZ-143ONEZ143118onez00143
    • 2018-05-25
    53 min

    [ETQR-042]Sex With A Little Devil Beautiful Girl Gal Erica Saeki

  • erika kashiwagi censoredcreampieblowjobETQRerotic timeETQR-042ETQR042h-1186etqr00042
    • 2018-05-18
    156 min

    [MMUS-020]Double Little Devil Beautiful Girl Temptation Shuri Atomi & Ai Hoshina

  • sena ai atomi shuri censoredschoolgirlbeautiful girlMMUSmarriontakato kasaimcpMMUS-020MMUS020mmus00020
    • 2018-04-22
    117 min

    [XVSR-364]The White Robed Fallen Angel A Little Devil Nurse Vs A Hungry Maso Nurse Mami Nagase

  • asami nagase censoredbig titssquirtingXVSRmax ael ochoXVSR-364XVSR364xvsr00364
    • 2018-04-14
    119 min

    [BLK-362]Little Devil In Uniform Gal Of The Day A Secret Panty Shot Temptation Sex Club Erica Saeki

  • erika kashiwagi censoredcreampieuniformBLKkira kirakira kira black galBLK-362BLK362blk00362
    • 2018-02-25
    137 min

    [MMUS-018]Sexy Slutty Little Devil Aoi Kururugi

  • aoi kururugi censoredbeautiful girlsingle workMMUSmarrionkijin kasaikcpMMUS-018MMUS018mmus00018
    • 2018-01-19
    132 min

    [DIC-004]These Horny Little Devil Beautiful Girl Babes Were Tempting Me With Panty Shot Masturbation

  • natsuki rua censoredbig titssingle workDICdickyDIC-004DIC004118dic00004
    • 2017-12-27
    171 min

    [IPX-071]A Little Devil Little Sister Who Likes To Get Her Cherry Boy Big Brother Hard And Horny Tsumugi Akari

  • akari tsumugi censoredschoolgirlbeautiful girlIPXidea pocketkyoseidishIPX-071IPX071ipx00071
    • 2017-11-17
    148 min

    [DOHI-061]This Little Devil Lolita Slut Looks Innocent But She Is Trying To Lure Her Private Tutor (Who Doesn't Seem To Have Much Experience With Women) To Temptation By Getting His Dick Hard With Pull Out Cowgirl Sexual Teasing For Massive Cream

  • sakaegawa noa ohara tin censoredcreampiebeautiful girlDOHIoffice k sgonzaburo onigawarainsertDOHI-061DOHI06136dohi00061
    • 2017-09-15
    137 min

    [RDT-288]This Little Devil Likes To Tease Me Because I Have No Female Presence In My Life, And Lures Me To Temptation No Matter Who's Watching! I Don't Know If She Got Excited At Herself, But In The End She Spread Her Pussy Lips Wide...

  • sea sky flower momoki nozomi censoredbeautiful girlslutRDTprestigeupdatingRDT-288RDT288118rdt00288
    • 2017-06-24
    146 min

    [SNIS-946]A Little Devil JK Who Lures Me To Temptation With Panty Shot Action Arina Hashimoto

  • there is hashimoto censoredschoolgirlbeautiful girlSNISs1 no 1 styletaro ryogokuSNIS-946SNIS946snis00946
    • 2017-04-26
    130 min

    [SHIC-072]A Bitchy Little Devil Who Lured Her Private Tutor To Temptation Haru Sakura Rumi Haruno Hina Sasaki

  • sakura haru harumi harumi censoredbeautiful girlSHICadolscence.comSHIC-072SHIC072h-839shic00072
    • 2017-04-01
    129 min

    [AMBI-077]An Obedient Girl Who Was Fucked Like A Pig Miyuki

  • sakura miyuki censoredcreampieschoolgirlAMBIplanet plusAMBI-077AMBI077h-237ambi00077
    • 2016-09-30
    122 min

    [MMUS-002]A Tempting Little Devil Gal Lena Aoi

  • blue censoredbeautiful girlsingle workMMUSmarrionkasai kijinMMUS-002MMUS002mmus00002
    • 2016-05-15
    118 min

    [IPZ-751]Cutie Perverted Gal, Sweet Little Devil. The Temptation Of A Very Sweet, Teasing Little Devil. Mayu Nozomi

  • nozomi eyebrows censoredbeautiful girlslutIPZidea pocketjiro tsubuyakidishIPZ-751IPZ751ipz00751
    • 2015-10-29
    119 min

    [WANZ-406]Rape Devil's Dick Strikes Yu Asagura

  • yu asakura censoredcreampiebeautiful girlWANZwanz factorywanzWANZ-406WANZ406wanz00406
    • 2012-04-13
    121 min

    [XV-1015]New Comer Flamboyant Little Devil G-cup Yui Hoshino

  • hoshino yui censoredbig titsbeautiful girlXVmax akyouseiXV-1015XV101560xv01015



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download