• Log in

  • Sign up
Jav Sushi
  • Home
  • Jav Uncensored
  • Jav Censored
  • New Releases
  • Trending
  • actors
  • Tags
  • Random Videos
  • Upload your videos
    • Log in
    • Sign up
  • Home
  • Jav Uncensored
  • Jav Censored
  • New Releases
  • Trending
  • Random
  • amateur

  • anal

  • bdsm

  • big tits

  • blowjob

  • bukkake

  • cosplay

  • creampie

  • cumshot

  • deepthroat

  • handjob

  • hardcore

  • japan

  • lesbian

  • lingerie

  • maid

  • married woman

  • massage

  • milf

  • nurse

  • office

  • outdoor

  • school

  • schoolgirl

  • single work

  • squirt

  • teacher

  • teen

  • uniform

delusion group jav upskirt leg fetish high vision




FC2EBODNGODONEZCESDRBDNACXNATRVENXAUKGADNVENUAPODVEMAMIDEHMNSQTESPRDHDKADTTMIAA

2018-12-07
163 min

[MEAT-017]Voluptuous Thighs In Knee-High Socks Total Domain Momo Shiraishi

  • momo shiraishi censoredsingle workMEATbig fleshy road family daydreamomaruMEAT-017MEAT017meat00017
  • 2018-04-22
    99 min

    [ONIN-028]I Want To Have A Face Sitting By A Lady In Cotton Panties With A Huge Ass! This Voluptuous Big Thigh Girl In Knee-High Socks Is Cumming At You Hard With Her Big Ass In Her Cotton Panties!

  • censoredONINtamanegi mousouzokudoryuu barimoatamanegiONIN-028ONIN028onin00028
  • 2017-11-04
    140 min

    [KAGP-024]My Nickname Is "The Professor" I'm A Weakling And A Loser With The Ladies, But One Day A Girl From Class Came To My House So We Watched AV Videos Together Her Panties Got Dripping Wet Just From Watching These Videos, So I Knew S

  • censoredcreampieschoolgirlKAGPkaguya hime pt mousozokuno tonKAGP-024KAGP024kagp00024
  • 1



  • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download
    • Legal

    • 18 U.S.C. 2257
    • Contact Us
    • DMCA
    • Useful

    • Sign up
    • Log in
    • FAQ
    • Contact
    • Friends

    • Girls Do Porn
    • GirlsDoPorn
    • DaftSex
    • TayLee Wood
    • WoodmanCastingX
    •